KEGG   Alligator mississippiensis (American alligator): 102577181Help
Entry
102577181         CDS       T03087                                 

Gene name
POLD1
Definition
(RefSeq) DNA polymerase delta catalytic subunit
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj03030  DNA replication
amj03410  Base excision repair
amj03420  Nucleotide excision repair
amj03430  Mismatch repair
amj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:amj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102577181 (POLD1)
   03410 Base excision repair
    102577181 (POLD1)
   03420 Nucleotide excision repair
    102577181 (POLD1)
   03430 Mismatch repair
    102577181 (POLD1)
   03440 Homologous recombination
    102577181 (POLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:amj03032]
    102577181 (POLD1)
   03400 DNA repair and recombination proteins [BR:amj03400]
    102577181 (POLD1)
Enzymes [BR:amj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     102577181 (POLD1)
DNA replication proteins [BR:amj03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    102577181 (POLD1)
DNA repair and recombination proteins [BR:amj03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      102577181 (POLD1)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     102577181 (POLD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B_exo1
Motif
Other DBs
NCBI-GeneID: 102577181
NCBI-ProteinID: XP_014466503
LinkDB All DBs
Position
Un
AA seq 423 aa AA seqDB search
MASQERIQLRMHSAILAAPLKGQASGIPTAHVPLSIRPSATLKMAIGSRGGNTCVRRPMG
GGLVWEPRGGTTLGSASFWIGGRVGAGAGGSTMEAKRKVSPAGPGPEDPSQWKRPRGGDW
EDENPSQFEEALAYLDEVESEMTLEMESSSQLLDVMAIGSLFSSVLNPKWQRPAPPGIDP
AADALCFQQVELDYYVGSPFPGMPGATQGPVPVLRMFGVTKAGNSVCCHIHGFAPYFYVP
APSGFQAQHLGEFQRELNGAVLRDMRSNKDGLSQAVLAVELCSKESMYGYHGQRLMPFLK
VVMALPRLIAPAKRLLEQGLRCGTLGLHGFQAYEANIDFEIRFMVDRDIVGCNWIELPPG
TYQLRTELASGEASKDNPAKASLCQLEVDVAWTDFVSHPPEGEWQGIAPLRVLSFDIECA
GRK
NT seq 1270 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcaggagcgcatccaattgcgcatgcactctgcgatcctggctgccccactg
aagggccaggcttctgggatccccactgcgcatgtgccgctctccataaggccttccgcc
acgctcaagatggcgatcggaagtcgcggtgggaacacgtgtgtgcggcgtccaatggga
ggggggttggtatgggaaccgaggggtgggaccacgctgggctccgcctccttttggatt
ggcgggagagtcggagctggagctgggggatccaccatggaggccaagcggaaggtatcc
ccagcggggcctggcccagaggacccctcacagtggaagcggccacgggggggtgactgg
gaggatgagaacccctcacagtttgaggaggcactggcctacctggatgaggtggagagc
gagatgactctggagatggagtcgtcatctcagttgcttgatgtcatggccatcgggagt
ctgttctcctcggtgctgaaccccaagtggcagcgcccagcaccccctgggatcgaccct
gcagctgatgcactctgcttccagcaggtggagctggattattatgtgggctctccattt
cctgggatgccaggtgccacacagggcccagtgcccgtgctccgtatgtttggtgtcact
aaggctggcaacagtgtatgttgccacatccatggctttgccccctacttctatgtgcct
gcccccagtggcttccaggcccagcacctgggtgagttccagcgggagctgaacggggct
gtgctgcgggacatgcgctccaacaaggatgggctgagccaggctgtgttggccgtggag
ctgtgcagcaaggagagcatgtacgggtaccatgggcaacggctcatgcccttcctgaag
gtagtgatggctcttccccggctcatcgcccctgccaagcggctgctggagcagggcctg
cgctgcgggaccctcggcctacatggcttccaggcctacgaggccaacatcgactttgag
atcaggttcatggtggaccgggatatcgtgggctgtaactggatagagcttcctcctggc
acataccagctgcgcacagagctggcctcaggggaggcctccaaggacaatccagcaaag
gcatctctctgccagctggaagtggatgtggcctggacagactttgtgagccacccccct
gagggcgagtggcagggcattgcacctctgcgtgtgctcagctttgacatagagtgtgct
gggcgcaaag

DBGET integrated database retrieval system