KEGG   Alligator mississippiensis (American alligator): 102577198Help
Entry
102577198         CDS       T03087                                 

Gene name
ME1
Definition
(RefSeq) malic enzyme 1
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00620  Pyruvate metabolism
amj01100  Metabolic pathways
amj01200  Carbon metabolism
amj03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    102577198 (ME1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102577198 (ME1)
Enzymes [BR:amj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     102577198 (ME1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic NAD_binding_3
Motif
Other DBs
NCBI-GeneID: 102577198
NCBI-ProteinID: XP_006258470
UniProt: A0A151MU30
LinkDB All DBs
Position
Un
AA seq 574 aa AA seqDB search
MERVRRPAGPRRPQLLAPQRGYALTRDPRLNKGMAFTLEERQQLNIHGLLPPCFLSQEVQ
VLRILTNFERQASDLDRYILLMGLQDRNEKLFYKVLTSDIEKFMPIVYTPTVGLACQLYG
LAFRRPRGLFITIHDRGHIATILKSWPENVIKAIVVTDGERILGLGDLGSYGMGIPVGKL
ALYTACGGMKPQECLPVMLDVGTDNEELLKDPLYIGLRHKRVRGQAYDDLLDEFMQAVTS
RYGMNCLIQFEDFANANAFRLLHKYRNIYCTFNDDIQGTAAVAVAGLLAALRITENKLSD
HTILFQGAGEAALGIANLIIMAMQKEGTAEDEAIKKIWMVDSKGLIVKERSSLTAEKKRF
AHKHDEMKNLEDVVKDIKPSVLIGVAAIGGAFTKEILKDMASFNKRPIIFALSNPTSKAE
CSAEQCYQVTQGRGIFASGSPFDPVTLPDGCTLYPGQGNNAYVFPGVALGIVSCGVRHIT
DEIFLTTAEVIAQQVSEKHLQEGRLYPPLMTIQDVSLKIAVKIAEQAYSNNTASFYPEPK
DKEALIRSQVYSTDYEDFMAESYAWPEEAMKIQT
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgttcggcgcccggccgggccccgcaggccccagctgctcgccccgcagcgc
ggctacgccctcacccgcgacccgcgcctcaacaagggcatggcttttactttggaagag
agacagcagttgaatattcatggactactgccaccttgctttcttagtcaagaagtccag
gttttaaggattctcacaaattttgaaagacaggcatctgacctagacagatacattctc
ttaatgggccttcaggatcgaaatgaaaagcttttctataaagtgctgacttctgacatt
gaaaagttcatgcctattgtttatactcccactgtgggtctggcttgccaactgtatggt
ttagcatttcggaggccaagaggtctttttatcaccatccatgaccgtgggcacatcgct
acaatacttaaatcctggcctgaaaatgtcatcaaggctattgtggtgactgatggagaa
cgcattcttggccttggggaccttggcagttatggaatgggcatcccagttggcaaactg
gcactttacactgcatgtggaggaatgaaacctcaggagtgtctgcctgtaatgctggat
gtgggaacagataatgaggagttactaaaagatcctttgtatattggactgagacacaaa
agagtgagaggtcaagcctatgatgatcttcttgatgaattcatgcaagctgtgacttca
aggtatgggatgaattgcctcattcagtttgaagattttgctaatgctaatgcattccgc
ctcttgcataagtaccgcaacatatattgcactttcaacgatgacattcaaggaaccgca
gctgtggctgttgcaggtctccttgcagctctacgtatcactgagaacaagctgtcagat
cacacaatactattccaaggagctggagaggctgccttggggatagcaaatcttattatt
atggctatgcaaaaagaagggacagctgaagatgaagctatcaaaaagatatggatggtt
gactcaaaaggattaatagttaaggaacgttcctcactaacggctgagaaaaaacgtttt
gcccataaacatgatgaaatgaaaaatctagaagatgttgtcaaagatataaaaccatct
gtacttataggagttgctgcaattggtggtgcttttacaaaagaaattctcaaagatatg
gcatctttcaacaaacggcctatcatttttgctctcagcaatccaactagcaaagcagag
tgctctgctgaacagtgctaccaagtaacacagggacgtggtatttttgcaagtggaagt
ccttttgaccctgtcacacttccagatgggtgcactctctatcctggacaaggtaacaat
gcctatgtgtttcctggagttgcccttggcattgtttcctgtggagtgaggcatataact
gatgaaattttcctcactactgctgaggtgatagctcaacaggtttcagagaaacactta
caggaaggccgtctgtaccctccattaatgactattcaagatgtgtcactgaaaattgct
gtgaagattgcagaacaagcctacagcaataacacagcctctttctaccctgagcccaaa
gacaaggaagcattgattcgctctcaggtctacagcactgattatgaagacttcatggct
gaatcttatgcctggcctgaggaagccatgaaaatacaaacttaa

DBGET integrated database retrieval system