KEGG   Alligator mississippiensis (American alligator): 106736742Help
Entry
106736742         CDS       T03087                                 

Gene name
OGDHL
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00020  Citrate cycle (TCA cycle)
amj00310  Lysine degradation
amj00380  Tryptophan metabolism
amj01100  Metabolic pathways
amj01200  Carbon metabolism
Module
amj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amj_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106736742 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    106736742 (OGDHL)
   00380 Tryptophan metabolism
    106736742 (OGDHL)
Enzymes [BR:amj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     106736742 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 106736742
NCBI-ProteinID: XP_006270227
LinkDB All DBs
Position
Un
AA seq 1011 aa AA seqDB search
MSPLRLLVVTLKHPGIRFLKNQDVARKVFLQNRLCVSSRATEPFLSGSNSNYVEEMYYAW
LENPKSVHKSWDLFFQNANAGAPPGQAYLPDCSSLLQSHGLTQTAYKAEKLVEDHLAVQS
LIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLGFYGLHESDLDKVFRLPTTT
FIGGNEATLSLREIIKRLESTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMKFTNEEKR
TLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIEYVIMGMPHR
GRLNVLANVIRKELEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRATNKKITLSLVA
NPSHLEAVDPVVQGKTKAEQFYRGDTEGKKVMSILLHGDAAFAGQGVVYETFHLSDLPSY
TTNGTIHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCNVAAE
WRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKLIADGTVTL
QEFEEEIAKYDRICEEAYTRSKDKKILHIKHWLDSPWPGFFNLDGEPKSMTCTPTGIAED
MLTHIGSIASSVPLEDFKIHTGLSRILKARMEMTKNRVVDWALAEYMAFGSLLKEGIHVR
LSGQDVERGTFSHRHHVLHDQEVDKRTCVPMNHLWEQQAPYTVCNSSLSEYGVLGFELGF
AMASPNALVCWEAQFGDFHNTAQCIIDQFISSGQAKWVRHNGIVLLLPHGMEGMGPEHSS
ARPERFLQMSNDDPDAYPEFSEHFEVSQLYECNWIVVNCSTPANYFHVLRRQISLPFRKP
LIILTPKSLLRHPEAKSNFDEMVSGMSFRRVIPEEGIAVEVPNKVKRVIFCTGKVYYDLL
KERKNQDLEGQVALTRLEQISPFPFDLLKEELERYPGADLVWCQEEHKNSGFYDYVKPRF
RTIVNHTRPIWYVGREPAAASATGNKNTHMVSLRKFLDTAFNLEAFEGKMF
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgagtcctttgaggttgcttgtagttaccttaaaacatcctggcattcgatttttgaaa
aatcaagatgtggccagaaaggtatttctacagaaccgactttgtgtttcatccagagcc
acagaaccattcctgagtggaagtaattcaaattatgtggaagaaatgtattatgcatgg
cttgaaaaccctaaaagtgttcataagtcttgggatttgttttttcaaaatgccaacgct
ggggctcctcctggtcaggcgtacttaccagactgttcatcactgcttcagagccatgga
ctgacccagacagcatataaagccgaaaaactagttgaggaccacctagctgtgcagtct
ttgattagggcttatcaaatccgtgggcatcatgtggctcagttggatcccctaggaatt
ctggatgctgacttggattcatttgttccatctgacttaatcaccactattgataaactg
gggttttatggtttgcatgaatctgacctggacaaggttttcagattgcctaccaccacc
ttcataggaggaaatgaggcaacgctttctctacgagaaatcatcaagcggttggagagc
acgtattgtcagcacattggactggagttcatgtttatcaatgatgttgagcaatgccag
tggatccggcagaagtttgagactcctggtgtcatgaaatttacaaatgaggaaaaaagg
actttattggctaggctggtacgctcaatgagatttgaagatttccttgcccgcaagtgg
tcttcagagaagcgctttggtttggaaggttgtgaagtaatgatccctgcccttaagacc
attattgataaatccagtgagatggggattgaatatgtaataatggggatgcctcacaga
ggcaggctaaatgtgttggccaacgttattcggaaggaactggagcagatcttctgtcag
tttgatcctaaacttgaagcagctgatgagggatctggggatgtaaaatatcatttggga
atgtaccatgagaggatcaaccgagcaacaaataagaaaatcaccctttcgcttgtggct
aacccatctcatttggaagcagtggaccctgttgtacagggaaagactaaagcagaacag
ttctaccgaggagatacagaagggaaaaaggtcatgtccatattgctacatggagatgct
gcttttgctggacagggagtggtgtatgaaacctttcatctcagtgatctgccatcgtat
actacaaatggcactattcatgttgtggtcaacaaccagattggcttcaccacagatccc
cgaatggcccgctcctctccgtaccccactgatgttgctcgtgtagtcaacgcacccatt
ttccacgtgaatgctgatgaccctgaagcagtgatgtatgtgtgcaacgtagctgcagaa
tggagaaatacattcaataaagatgtggttgtagacttagtctgttaccgaaggagaggc
cacaatgaaatggatgaacccatgttcacccagcccctgatgtacaagcagatccacaag
caggtgccagtgctgaagaaatatgctgacaaactgattgcagatgggactgtaacactg
caggagtttgaggaagaaattgcaaagtatgatagaatctgtgaagaagcttatacaaga
tctaaagataaaaaaattctacatattaagcactggcttgattcaccttggcctggcttc
tttaatttggatggagaaccaaagagcatgacttgtactcctactggcattgcagaagac
atgctgactcacattggcagtatagccagctctgtgccacttgaagatttcaaaatacat
acaggactctctcgcattttgaaagcccgtatggaaatgacgaagaatagagttgttgac
tgggccttagcagaatatatggcttttggatctttgctgaaagaagggatccatgttcga
ctgagtggacaggatgtggaaaggggcactttcagccatcgccatcatgtgctccatgat
caagaagttgacaagaggacatgcgttcctatgaatcacctctgggagcagcaagccccg
tacacagtgtgtaacagctccctttcagaatatggcgtcttaggttttgagcttggcttt
gccatggcaagtcccaatgctctggtgtgctgggaagctcaatttggtgactttcacaac
actgcacagtgcataatagaccagttcatcagctcggggcaggcaaagtgggttcgtcac
aatgggattgtgctgcttttgccacatggaatggaaggaatgggcccagagcattcttca
gccaggcctgagagatttctgcagatgagcaatgatgatcctgatgcttatccagagttt
agtgaacactttgaagtttcccagctctacgagtgcaactggattgtggtgaactgttca
actccagccaattattttcatgtcctcagaagacagatctcactgccgttcaggaaacca
ctgatcattttgacacccaagtcactgctgaggcatcctgaagccaaatccaattttgat
gaaatggtatctggtatgagcttcagacgagtgattccagaggaaggaattgcagtggaa
gtgccgaataaggttaagcgggtgattttctgtacggggaaagtgtactatgatcttctt
aaagagagaaaaaaccaagatttggaaggacaagtggctctaactcgactagagcagatc
tctccattcccctttgatctgttaaaggaagagcttgagagatatcctggagctgatcta
gtttggtgtcaggaggagcacaaaaatagtggattctatgactatgtgaaacctcgtttc
cgcactattgtgaaccacacacgacccatatggtatgttggccgagaaccagctgctgct
tctgccacaggtaacaagaacactcatatggtgtcactcagaaaattcctggacacggct
ttcaacctagaggcctttgaaggaaagatgttctga

DBGET integrated database retrieval system