KEGG   Alligator mississippiensis (American alligator): 106736995Help
Entry
106736995         CDS       T03087                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00590  Arachidonic acid metabolism
amj01100  Metabolic pathways
amj04370  VEGF signaling pathway
amj04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106736995 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    106736995 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106736995 (PTGS2)
Enzymes [BR:amj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     106736995 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 106736995
NCBI-ProteinID: XP_006267636
UniProt: A0A151MIJ3
LinkDB All DBs
Position
Un
AA seq 605 aa AA seqDB search
MLLLYASVIALVLAAGRAANPCCSNPCQNRGVCLTTGFDKYECDCTRTGYYGENCTTPEF
FTWLKITLKPTPNTVHYILTHFKGVWNIINNIPFLRDAIMRYVLTSRSHLIDSPPTYNSE
YGYKSWEAFSNLSYYTRALPPVARDCPTPMGVKGKKELPDSKLVVEKFLLRKKFIPDPQS
TNIMFTFFAQHFTHQFFKTDHHKGPAFTKGLGHGVDLNHIYGETLDRQLKLRLGKDGKLK
YQMIGGEMYPPTVKDTQAEMMYPPHVPEHLQFSVGQEVFGLVPGLMMYATIWLREHNRVC
DILKQEHPEWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQKFQY
QNRIAAEFNTLYHWHPLLPDTFQIHDQEYTFQQFLYNNSIMLEHGLSHMVKSFSKQIAGR
VAGGKNVPAAVQKVAKASIDQSRQMRYQSLNEYRKHFLMKPFKSFEELTGEKEMAAELEE
LYGDIDAMELYPGLLVEKPRPGAIFGETMVELGAPFSLKGLMGNAICSPEYWKPSTFGGR
VGFEIVNTASLQKLICNNVKGCPFTAFHVLNPESTEAATINVSTSNSAIDDINPTLLLKE
RSAEL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgctctacgcttccgtgatcgcgctcgtcctggccgccggccgcgcagctaat
ccctgctgctcaaatccatgtcagaacagaggagtttgtttgacaacaggctttgacaaa
tacgaatgtgactgtacaaggaccgggtattatggggaaaactgcactacacccgaattc
tttacgtggttgaaaatcacattgaagcctactcccaacaccgtccactacatcctcacg
cacttcaagggagtctggaatattataaacaacattcctttcttacgtgatgccatcatg
cgatatgtattgacatcaaggtcacatttgattgacagtcccccaacatacaatagtgaa
tacggttacaaaagctgggaagccttttccaacctttcctactatacaagagcccttccg
ccagtagcacgagactgcccaacacccatgggtgttaaaggtaaaaaggaactcccagat
tccaagttagttgtggagaagtttctgctgaggaaaaaatttattccagatccacagagc
acaaatattatgttcacattctttgctcaacacttcacccaccagttctttaagactgat
caccacaaaggaccagccttcacaaaaggccttgggcatggggttgatttgaaccatatc
tatggagagactttggacagacagcttaagctcaggcttggtaaagatgggaagctaaag
tatcagatgattggtggagaaatgtaccctccaacagtgaaggatactcaagcagaaatg
atgtatcctcctcatgttcctgagcatctacaattctctgtaggacaggaggtgtttggt
ctggtcccaggtttaatgatgtatgctaccatatggctcagggagcacaaccgggtctgt
gacatccttaagcaggaacatccagaatgggatgatgaacggttattccaaactaccaga
ctcatattgataggggagaccatcaagattgtcattgaagactatgtgcaacacttgagc
ggctaccatttcaagctgaagtttgatcctgagcttctgtttaaccaaaagtttcagtac
cagaacagaattgcagctgaattcaacactctgtaccactggcaccctcttctacctgac
acgttccagatacatgaccaggaatacacattccagcagtttctttacaacaactccata
atgctggagcatggcctttcccacatggtgaaatccttctccaagcaaattgctggcagg
gttgctgggggtaaaaacgttcctgctgcagtacagaaagttgccaaggcatcaattgac
caaagcagacagatgagataccaatccttgaatgaataccggaaacacttcctcatgaaa
ccctttaaatcatttgaggaacttacaggagaaaaagaaatggcagctgaactggaagag
ctttatggagacattgatgctatggagctgtatcctggtctgttagtagaaaagccccgt
ccaggagccatctttggtgagactatggtagagcttggagcaccattctcgttgaaaggc
ctgatgggaaatgctatctgctctcctgagtactggaagcctagcacttttggtggaaga
gtaggctttgaaatagtcaacactgcctccctgcaaaaactcatctgcaacaacgtaaag
ggttgtccctttacagcttttcatgtcctaaaccctgaatccactgaagcagcaactatt
aatgtcagtacctcaaactcggcaatagatgatatcaaccccacattactactgaaagaa
agatctgcagaattatag

DBGET integrated database retrieval system