KEGG   Alligator mississippiensis (American alligator): 106737013
Entry
106737013         CDS       T03087                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00220  Arginine biosynthesis
amj00330  Arginine and proline metabolism
amj01100  Metabolic pathways
amj04020  Calcium signaling pathway
amj04146  Peroxisome
amj04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    106737013 (NOS2)
   00330 Arginine and proline metabolism
    106737013 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106737013 (NOS2)
   04020 Calcium signaling pathway
    106737013 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106737013 (NOS2)
Enzymes [BR:amj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     106737013 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 106737013
NCBI-ProteinID: XP_019348966
LinkDB
Position
Un
AA seq 1152 aa
MLCPWQFAFKNQASKNRSFEEKDVNNNVEKAAMKDHSLMKEDADNLSKKQNEIPYVKTAA
EKPPQNGIKPANQNPRCPRYVKIKNMENGSILQDTLHLQAKEVMNCRTKACQGALMTPKG
FMRGPRDKPVPPEELLPQAIEFVNQYYGSFKEPKVEEHLARMEAVNKEIETTGTYQLTKD
ELIFATKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEHICRHIEYSTNNGNIRSAI
TVFPQRTDGKHDFRIWNGQLIRYAGYQMPDGSIIGDPGCVQLTQLCIDLGWKPKYGRFDL
VPLIIQANGQDPEIFELPPEIILEVPMEHPKYEWFKDLDLKWYAMPAVANMLLEVGGLEF
TGCPFNGWYMGTEIGVRDFCDVQRYNILKEVGRRMGLDTNKLSSLWKDQAVIEINIAVLY
SFQKQNVTIMDHHSAAESFMKYMQNEYRVRGGCPADWVWLVPPISGSITPVFHQEMLNYV
LSPFYYYQEDAWKTHVWHDETRRPKKKEIKFSVFAKAAFFASSLMRKTMAARSKATVIYA
TETGKSETLANNLRDLFNCAFNTRILCMDDYKISDLEKENLLLVVTSTFGNGDSPGNGKK
LKDSLFAMKKLNKKLRYAVFGLGSTMYPEFCAFAHAIDQKLAQLGASQITATGEGDELNG
QEEAFRAWAVNAFKTACEIFDVRGKNSIQVPKMYTADESWNPKNYRVVYDSQALDLSKGL
ADIHAKNVIPMKLKFRQNLQSSKSSRVTILVKLSCESNQEMQYLPGDHVGIFPGNQPELV
QGITELLKDAPPADQTVRLETYNDGGYWTSDKKIPPCTLSEALTYFLDITTPPSQQLLKK
LSQLAAEEGDKQRLEVLCHSLEKYNDWKFFNSPTILEVLKEFPSIKVSTPFLLTQLPLLK
PRYYSISSSHDMSPREVHLTVAVVNYRTKDGQGPLHHGVCSTWLNTLNLSESVPCFVRSA
AGFQLPKDPSTPCILIGPGTGIAPFRSFWQQRLHDLEKKGIKGSGMTLLFGCRRSDTDHI
YGEETEEMKRMGVLKEVYTAYSRQPGQAKVYVQDILRSKLEAEVHQVIHEDKGHLYVCGD
VRMARDVAQTLREMFAKRLKLTEEQAEEYVSQLKSQKRYHEDIFGAVFPRNHKRDGKASK
PTSQRTDQQLTF
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgctgtgcccttggcaatttgcattcaagaatcaagccagtaagaaccggtcctttgaa
gagaaagatgtaaataataatgtggaaaaagcagccatgaaagatcacagcttaatgaaa
gaagatgccgataacctgagcaagaaacagaatgagataccgtatgtcaaaactgcagcc
gagaaacctccacaaaatggcatcaagccagcaaaccaaaatccgaggtgcccaagatat
gtaaaaataaaaaacatggaaaatggcagcatccttcaagatacattgcaccttcaggca
aaggaggttatgaactgcaggaccaaggcttgccaaggggcactgatgaccccaaaaggt
tttatgagaggccctagggacaagccagtgccaccagaggaacttctacctcaggcgata
gaatttgtcaatcagtactacggctcgttcaaagaaccaaaagtagaagaacatctggcc
cgaatggaagcagttaataaagagatagaaacaacaggaacctatcagctgaccaaagat
gaacttatctttgcgaccaaacaggcctggagaaatgctccaagatgcataggaagaatc
cagtggtccaatctacaggtgtttgatgcacgtgactgtaaaacagccaaggaaatgttt
gaacatatctgtcgccacattgaatactccacaaacaatggaaatataaggtcggccatc
actgtcttccctcaacggactgatgggaaacatgattttcgcatatggaatggccagctc
atccgatacgctgggtaccaaatgccagatgggtccatcatcggagacccaggctgtgtg
cagctgacacagttgtgcattgatcttgggtggaagcccaagtacggtcgctttgattta
gttccactgattatccaagcaaacggccaagacccggaaatatttgaactgcctccagaa
attatccttgaagtgccaatggagcatccaaagtacgaatggtttaaagacctggatctg
aagtggtatgcgatgcctgctgtggccaacatgttgctcgaagtgggaggcctggaattc
actggctgccctttcaacggctggtacatgggcaccgagataggcgtgcgagatttctgc
gatgtgcaacggtacaacatccttaaggaagtaggaagaaggatgggtctggacacaaac
aaactttcttcactgtggaaagatcaagctgttatagagattaacatcgctgtgctttat
agcttccaaaagcaaaatgtcaccatcatggatcaccactctgctgctgagtccttcatg
aaatacatgcagaatgagtaccgtgttcgaggaggttgtccggcagactgggtttggctt
gtgcctccgatatcagggagcattaccccagtatttcaccaggagatgctgaactatgtg
ctttcaccattctattactaccaggaggatgcttggaaaactcacgtctggcatgatgaa
acacgcaggccaaagaaaaaggagataaagtttagtgtttttgcaaaggctgcattcttt
gcctcttcactgatgcggaaaacaatggcagccaggtctaaagcaactgtgatatatgcg
acagagacagggaaatctgaaaccctggccaacaacctgcgtgacttattcaactgtgcc
ttcaataccaggattctttgtatggatgactataagatcagtgacctggagaaagaaaat
ctccttctggtggtgaccagcacttttggaaatggagattcacctggcaatggaaagaaa
ctgaaggattccctgttcgctatgaaaaagctgaacaaaaaactcagatatgctgtattt
ggcctgggatcaaccatgtatccagagttctgtgccttcgctcatgccattgaccaaaaa
ctcgcacagctaggtgcctctcagatcaccgcaacgggtgaaggggatgaactcaatggg
caggaagaagcctttcgtgcctgggcagtgaatgcattcaagactgcctgtgagatcttt
gacgtccgtgggaaaaacagcattcaggtacccaagatgtataccgctgatgagtcctgg
aatcctaagaactacagggtggtgtatgactcccaggctttggacttgagtaaaggactt
gctgacatacatgcaaagaatgtaattccaatgaagctcaaatttaggcagaacctgcaa
agttcaaaatccagtcgtgttaccatccttgttaagctttcctgtgagtctaatcaggaa
atgcagtacctgcccggagatcacgttgggattttcccaggcaaccagccagaattagtt
cagggcatcactgagcttcttaaagatgcacccccagctgatcagaccgtccgactggaa
acctacaatgatggtggctactggacaagtgacaagaaaattccaccctgcacactctca
gaagccttgacatacttcctggatatcaccaccccaccctcacagcagctgctaaaaaag
ctctcccagctggcagcagaggaaggagacaaacagagactggaagtcttatgtcatagc
ttagagaagtacaacgactggaagtttttcaacagtcccaccatcctggaggtcctgaag
gaattcccttccattaaggtctcaacacctttcttgctgactcagttgcctttgctgaag
cccaggtactactccatcagctcctcacacgacatgtcacccagagaggtccatctgaca
gttgcggtggtcaactacaggacaaaggatggtcaaggtcccttacatcatggagtttgc
agtacatggctgaatacattaaatctcagtgaatcagtcccatgctttgtacgcagtgct
gccggattccagctcccgaaggacccatccacgccatgcattctgattggcccagggaca
ggaattgctccattcagaagcttctggcagcagcgtctccatgacttggaaaagaaagga
atcaaaggcagcggcatgacattactgttcggctgccggcgatcagatacggatcacatc
tacggagaagaaactgaggagatgaagagaatgggagtactcaaagaggtctacactgct
tactccaggcagcctggccaagcaaaagtctatgttcaagacattcttcggagcaagctg
gaggcagaagtgcaccaagtcattcatgaagacaaagggcatctgtatgtctgtggagat
gtgcgcatggccagggatgttgcccagaccttgagggagatgtttgctaagagactgaag
ctgacagaggagcaggctgaagaatacgtctcccagctcaagagccagaagcgataccat
gaagacatatttggggctgtgtttccacgtaaccacaaacgagatggaaaagcttcaaaa
cccaccagccaaagaacagatcagcagttaacattttaa

DBGET integrated database retrieval system