KEGG   Alligator mississippiensis (American alligator): 106737076Help
Entry
106737076         CDS       T03087                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04010  MAPK signaling pathway
amj04020  Calcium signaling pathway
amj04114  Oocyte meiosis
amj04140  Autophagy - animal
amj04261  Adrenergic signaling in cardiomyocytes
amj04270  Vascular smooth muscle contraction
amj04310  Wnt signaling pathway
amj04340  Hedgehog signaling pathway
amj04371  Apelin signaling pathway
amj04530  Tight junction
amj04540  Gap junction
amj04910  Insulin signaling pathway
amj04912  GnRH signaling pathway
amj04914  Progesterone-mediated oocyte maturation
amj04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106737076
   04310 Wnt signaling pathway
    106737076
   04340 Hedgehog signaling pathway
    106737076
   04371 Apelin signaling pathway
    106737076
   04020 Calcium signaling pathway
    106737076
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106737076
  09143 Cell growth and death
   04114 Oocyte meiosis
    106737076
  09144 Cellular community - eukaryotes
   04530 Tight junction
    106737076
   04540 Gap junction
    106737076
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106737076
   04912 GnRH signaling pathway
    106737076
   04914 Progesterone-mediated oocyte maturation
    106737076
   04916 Melanogenesis
    106737076
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106737076
   04270 Vascular smooth muscle contraction
    106737076
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amj01001]
    106737076
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:amj03019]
    106737076
   03036 Chromosome and associated proteins [BR:amj03036]
    106737076
Enzymes [BR:amj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     106737076
Protein kinases [BR:amj01001]
 Serine/threonine kinases: AGC group
  PKA family
   106737076
Messenger RNA biogenesis [BR:amj03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     106737076
Chromosome and associated proteins [BR:amj03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106737076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 106737076
NCBI-ProteinID: XP_006271168
LinkDB All DBs
Position
Un
AA seq 380 aa AA seqDB search
MSALQRLESLAGRIFSWGPRGDPGDPESTGRVPETEHAAAWNQQMKEFLAKAKEDFLKKW
ESPSQNTASLDQFDRIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLN
EKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYIPGGEMFSHLRRIGRFSEPHARFYAAQI
VLTFEYLHSLDLIYRDLKPENLLIDQQGYIEVTDFGFAKRVKGRTWTLCGTPEYLAPEII
LSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLR
NLLQVDLTKRFGNLKNGVADIKNHKWFGTTDWIAVYQRKVEAPFIPKCKGPGDTSNFDDY
EEEEIRVSLTEKCAKEFAEF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcactgcagaggctggagagcctggccgggcgcatcttctcctggggtccacgg
ggggaccctggggatcctgaaagcacagggagggttcctgagacagagcatgcagccgcc
tggaaccagcagatgaaggagttcctggccaaagccaaagaagatttcctcaagaaatgg
gagagcccatcacagaacacagccagtctggaccagtttgatcgcatcaagacgctgggc
acaggctccttcgggcgtgtgatgctggtgaagcacaaggagacaggcaaccactatgcc
atgaagatcctggataagcagaaggtggtgaagctgaagcagattgagcacaccctcaat
gagaagcgcatcctccaggctgtcaacttccccttcctcgtcaagctcgagtactccttc
aaggacaactccaacctgtacatggtgatggaatatatcccaggcggggagatgttctcc
catctacggcgaatcgggaggttcagcgagcctcatgcccggttctacgcggcccagatc
gtgctgaccttcgagtacctgcactcacttgacctcatctaccgtgacctcaagcccgag
aacctgctcatcgatcagcagggctacattgaggtgacagatttcggctttgccaagagg
gtgaaggggcgcacctggacgctgtgtgggacccctgagtacctggcacccgagatcatc
ctgagcaaggggtataacaaggctgtggactggtgggccctgggtgtcctcatctacgag
atggcggctggctacccccccttcttcgcggaccagcccatccagatctatgagaaaatc
gtctccgggaaggtgcggttcccgtcgcacttcagctcggacctcaaggacctgctgcgc
aacctgctccaggtcgacctcaccaagcgcttcggaaacctcaagaatggcgtcgcggac
atcaagaaccacaagtggtttggtaccactgactggattgctgtctaccagcgcaaggtg
gaagcccccttcataccaaagtgcaaaggccccggcgacacaagcaactttgatgactat
gaggaggaggagatccgtgtctcactcaccgagaagtgcgccaaggagtttgccgagttc
tag

DBGET integrated database retrieval system