KEGG   Alligator mississippiensis (American alligator): 106737180Help
Entry
106737180         CDS       T03087                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04110  Cell cycle
amj04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    106737180 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    106737180 (HDAC1)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106737180 (HDAC1)
Chromosome and associated proteins [BR:amj03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     106737180 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     106737180 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    106737180 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    106737180 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RNA_polI_A34
Motif
Other DBs
NCBI-GeneID: 106737180
NCBI-ProteinID: XP_019354401
LinkDB All DBs
Position
Un
AA seq 480 aa AA seqDB search
MALTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVISKVMETFQPSAVALQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQPIPEDAVQEDSGDEDEEDPDKRISIRNSDKRIACDEEF
SDSEDEGEGGRKNVANYKKAKRAKTEEDKEEEEKKDEKEEEKTKEEKAEPKGVKEETKSA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgacgcaggggaccaagcggaaagtctgttattactatgatggggacgttgga
aactactattatggccagggccatccaatgaagccccacaggatccgaatgacccataac
ctcctgctgaactatggcctttacagaaaaatggagatctatcgtccccacaaagcgaat
gctgaagaaatgaccaagtaccatagtgatgactacattaaatttctgagatctatacgc
ccagataatatgtctgagtacagcaagcagatgcaaagattcaacgttggggaagattgc
cccgtgtttgatggattgtttgagttttgtcagctgtctgcaggaggatctgtcgccagt
gctgtgaagctgaacaaacagcaaacagatattgctgtgaattgggcaggaggccttcac
catgctaagaagtcagaggcttctggtttctgttatgtcaatgatatagtcttagccatc
ttggaactgctaaagtaccaccagagagtgctgtatattgacattgatattcaccatgga
gatggtgtggaggaggccttttataccacagaccgtgtcatgacagtatccttccataaa
tatggagaatacttcccaggaacaggggacctgcgggatattggtgcaggcaaaggcaaa
tattatgctgtcaactatcccctccgggacgggattgacgatgagtcctatgaggcaata
tttaagccggtgatatctaaagtgatggagacgttccagcccagcgcagttgccctgcag
tgtggatcagattctctgtcaggggacaggttgggctgttttaatctgaccatcaaaggt
catgccaagtgtgtggagttcgtaaagagttttaatttgcccatgctgatgttaggagga
ggtggctacacgatccgcaatgtggctagatgctggacctacgagacggctgtagctttg
gacactgaaattccaaatgagcttccgtataatgactatttcgaatactttggaccagac
tttaaactccacatcagtccttcaaatatgaccaatcagaacaccaatgagtatcttgag
aagattaagcagcgtctctttgagaatttacgtatgcttcctcatgcccctggcgtccag
atgcagccaattcctgaggatgctgttcaggaagatagtggagatgaagatgaagaagat
cctgacaaacgcatttcaatccgcaattctgataagagaatagcctgtgatgaagaattc
tcagattctgaagatgaaggagaaggtggtcgcaaaaatgttgccaactataagaaagcc
aagcgtgcaaaaacagaagaggataaagaggaggaggagaaaaaagatgagaaagaagag
gagaaaacaaaagaggagaaagcagaacctaaaggggtaaaggaagagactaaatcagcc
taa

DBGET integrated database retrieval system