KEGG   Alligator mississippiensis (American alligator): 106737814
Entry
106737814         CDS       T03087                                 

Gene name
IFI16
Definition
(RefSeq) interferon-inducible protein AIM2
  KO
K12966  absent in melanoma 2
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04621  NOD-like receptor signaling pathway
amj04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106737814 (IFI16)
   04623 Cytosolic DNA-sensing pathway
    106737814 (IFI16)
SSDB
Motif
Pfam: HIN PYRIN tRNA_anti-codon
Other DBs
NCBI-GeneID: 106737814
NCBI-ProteinID: XP_014466650
LinkDB
Position
Un
AA seq 378 aa
MMSAPLHFLVHPSISSQNSFHLFLQFFHCSFLGNSADQRQLPPCDIPVSCSVLLDRMGAG
GAHCFDILLCGLSNLEEYDFKNFKGKLSDAERPYKIPLCKLENADVPTLANLMIQHFDRK
QAVTTTKRILRDLHLKEALNIMIEKAKKLSKAKGKKSLEKKPKSHPAKNTGQNTGSCKNQ
RTKNEMIKEPFVAKVIKVTKPLKYRYSDGKRKQVFHALVLNASAKTRIKIFDAEKHPLFK
KNKTIEISNYYKKEGYLQVVKHSICEIKEEELVIPKKMHKDAVKRTRIEDIWEMPEKSYV
DGTFTVKEKRLGKGYTCFTVTDDTGEIEVMVFDEVGNVKAAEGDKLQLTWFKRNVFNSKL
QLKSEMHSRIQVKKQRKK
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgatgtctgcccctctccatttcctggtgcatccttccatctccagccagaactctttc
cacttatttctgcagttctttcattgcagcttcttggggaactcggccgatcagcgacag
cttcctccgtgtgacatcccagtttcctgcagcgtgctcctggacaggatgggagcagga
ggtgcacactgctttgatatcttgctctgtggcctgagcaacttggaagagtatgatttt
aaaaatttcaaaggaaaattgtctgatgcggaacgtccctataaaattcccctgtgcaaa
ctggaaaatgctgatgtcccgacattagccaatctcatgattcagcacttcgacaggaag
caagcagtgacaacaacaaaacgcatcctaagagacctccatttaaaagaagctcttaac
ataatgattgagaaagctaagaaattatcaaaggcaaaaggaaaaaagtctctggagaag
aaaccgaagagccatccagcgaagaacacgggacaaaacactggatcctgcaagaatcaa
cgtacaaaaaatgaaatgatcaaagagccctttgtggccaaagtaataaaagtgacaaaa
ccattaaagtacagatattctgatggtaaaaggaagcaggtgtttcatgctcttgtgcta
aatgcatctgcaaaaacaaggattaaaatttttgatgcggaaaaacacccgctttttaaa
aaaaataaaacaattgaaatatcaaattattataaaaaagaggggtatttgcaagtagtg
aaacactcaatctgtgagataaaagaagaagaacttgtcattccaaagaaaatgcataaa
gatgctgtgaaaagaaccaggattgaagacatatgggagatgccagaaaagtcctatgtg
gatggaacttttacagttaaggagaaacggctgggaaaaggttacacctgttttacagtg
acagacgacacaggagaaatagaagtcatggtgtttgatgaagtgggtaatgtgaaagca
gcagagggcgacaaactccagctcacctggttcaaaagaaacgtgtttaactccaaatta
cagctcaaatcggaaatgcacagtcgaatccaggttaaaaagcaaagaaagaaatga

DBGET integrated database retrieval system