KEGG   Alligator mississippiensis (American alligator): 106738140Help
Entry
106738140         CDS       T03087                                 

Definition
(RefSeq) collagen alpha-2(IX) chain
Organism
amj  Alligator mississippiensis (American alligator)
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen Laminin_G_3 Laminin_G_2
Motif
Other DBs
NCBI-GeneID: 106738140
NCBI-ProteinID: XP_014450666
UniProt: A0A151NCZ7
LinkDB All DBs
Position
Un
AA seq 873 aa AA seqDB search
MADQISSVQGNKGGICILACIFLIMLSFHVSGQEHSGYQSGDEGTDRGTESYLYVHEADS
TLIDGYESGDDMRMTTTSFPYITDYPSSYYLEETTAAYYESISSGYYLNREEYTYPTPTE
PYDNAKEVITLTARTPFSRKKDPFSVPNVSGETEVIDLLRELGVPSASGVNTVPGSQSDR
TAYQLGPHVHITRKTRLLPPQGLSQEFSVVSTFRMREDTSQVVWDLWRVMDSARADQFRL
RLYGESSAVDIYSAAGEASGSELTTFENVEKLFDGTWHKLALSARRNQLTLYIDCQPVGT
APVSHYGAIRTDGNIVLAKRIKDDITTLVDVQQLQLYTDHNRAEDETCCEVPGVEDVRCG
SSGHRKIPETCSCQPGVPGYAGFPGTKGEKGDQGASGFPGLQGRQGDPGETGSEGPSGYS
GALGFIGIPGERGELGPPGKKGEPGLPGPEGESGIKGEAGDIGRSGEDGSSGAPGEEGSQ
GTPGKPGPPGPDGPKGFAGANGPKGAHGKQGSMGYPGAMGEAGEAGPKGDEGPMGIPGSD
GIPGRDGPLGIPGLEGEIGLMGPKGSKGEQGPKGPPGRSGSMGAKGVMGDPGLPGKPGSK
GIKGQKGAQGETGDQGPKGDTGRKGDIGDAGSQGDPGDRGDKGQQGECGSPGPVGPEGPR
GVPGLPGPRGFPGFVGENGIIGPPGPPGPRGPEGPGMPEEHVYELCRNVIIAQIAQYSAG
IRYKCASACPTANLTLIGPPGLPGMAGPPGKKGKPGLPGLTGKPGPRGPTGFPGVNGEVG
EPGEKGQKGDRGDLGKGLPGPDGPPGSIGVPGHPATAQDGQPGPTGPPGYSGPPGQPGFP
GPVGIPGLCEATDCGIYAPKLLAEQESVKGPAI
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcagatctcatctgtgcaagggaacaaaggtgggatttgcatactggcctgt
atatttcttattatgttgtcctttcatgtcagtgggcaagagcattcaggataccagtca
ggtgatgaaggtactgacagggggacagaatcatatctgtatgtgcatgaagcagacagt
acacttatcgatggctacgaatcaggagatgacatgaggatgaccaccacaagcttccct
tacataacagactaccctagcagctattacctagaggagaccacggctgcttattatgag
tcaatatcttctggatattatttgaacagagaggaatatacttatcctactccaacagag
ccctatgacaatgcgaaggaagttattaccctaaccgcgaggacaccattcagtagaaag
aaagatcccttctcagttcctaatgtctcaggggaaacagaagtcattgatctgttgcga
gaattaggagtccccagtgcttctggagtcaatactgttccaggatcacaaagtgaccgg
acagcatatcagcttggaccacatgtgcacattacaagaaaaaccagattacttccccca
caggggctctcccaggaattctctgtagtttctaccttcagaatgagggaggatacctct
caggtagtgtgggatctctggagagtgatggacagtgccagagctgatcagtttaggctg
cgtctctatggagaaagctctgcagttgacatatacagtgcagcaggagaagcatcaggt
agtgagctcaccacctttgagaatgtggagaagctttttgatgggacatggcacaagctt
gcccttagtgccaggagaaaccagcttaccttatatatagactgccagccagtgggcact
gcccctgtcagtcattatggagcaatcaggacagatggaaacattgtcttggctaagaga
ataaaggatgacatcactacactggtggatgtgcagcaacttcagctttacacagaccac
aaccgggcagaggacgaaacgtgttgtgaagtacctggagtggaagatgtccggtgtggg
agctcaggtcacaggaagattccagaaacctgcagttgccagcctggagtgccaggctat
gctggctttcctggtacaaagggtgaaaaaggtgatcaaggtgcctcaggcttcccagga
ttgcaaggaagacagggtgatccaggagaaacaggttctgaaggaccttctggatattct
ggagccctgggtttcatcggtatacctggagagagaggtgaattgggtcccccagggaaa
aagggtgaacctggtttgcctggacctgaaggtgaatctggaataaaaggagaagcaggt
gacattgggaggagtggtgaggatggcagctctggtgctccaggagaggagggttcacaa
ggaacaccaggaaaaccaggacctccggggccagatggaccaaagggctttgctggtgct
aatggacccaaaggagcccatggaaagcaaggatctatgggttatccaggagccatggga
gaagctggagaagcagggcctaagggagatgaaggacctatgggaatcccaggcagtgat
ggcattccaggaagagatggtccactgggaatcccaggattagagggtgagattggactc
atgggaccaaagggtagcaaaggtgagcagggtcccaagggaccaccaggaagatcaggc
tccatgggagccaaaggtgtgatgggtgatcctggtctaccaggtaaacccggttctaaa
ggaataaaaggccaaaagggggctcaaggtgagactggagatcaaggcccaaagggtgat
actggaagaaaaggagacattggggatgctggatcccagggtgatcccggagacagggga
gacaaaggccaacaaggagaatgtggatctcctggtccagttggtccagaaggcccaaga
ggtgtccctggtttacctggtccaagaggttttccaggctttgtgggggagaatggaata
attggtccccctggacctccagggcctcgtggacctgaggggccaggaatgcctgaggag
cacgtgtatgaactgtgtcgtaatgtgatcatagctcagatagcccaatattcagcaggt
atcagatacaaatgtgccagtgcttgtcccactgctaatctgacactaattggaccccca
ggacttcctggcatggcaggaccacctggaaaaaagggaaaaccaggtcttcctggactt
actgggaaacctggccccaggggacctactggatttcctggagttaatggagaagttggg
gaaccaggagaaaaaggccagaaaggtgatagaggagatctgggtaaaggactccctgga
ccagatggacctccagggtctataggggttcctggacatcccgctactgcccaagatggc
cagccaggcccaacaggccctcctggatacagcggccctcctgggcagcctggatttcct
ggtcctgtaggcatccctggcctgtgtgaagcaacagattgtggtatctacgctccaaaa
ctgctggcagaacaggaatctgtaaagggaccagcaatttaa

DBGET integrated database retrieval system