KEGG   Alligator mississippiensis (American alligator): 106738663
Entry
106738663         CDS       T03087                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106738663 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:amj04052]
    106738663 (EPO)
Cytokines and growth factors [BR:amj04052]
 Cytokines
  CSF and other factors
   106738663 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 106738663
NCBI-ProteinID: XP_019333473
LinkDB
Position
Un
AA seq 236 aa
MRSWIWGDWTPFTEHRENPGVRASITTHPRLQARPGGQPQHPGSRPPHSPCQRSQASGPA
PEDLGLWTLLSMLLLMPGPVQAGAPRPMCDPRVLEMFIRETQDAEKAAAACGAACDLPDI
LMLPETKVNFNEWQQMSWPARVQEVWGGHTLLVTALCRARELVTEPGTRVTLERMHNVVR
GVGQILRNHEAKPPPLAPPPGSPARSVLRLLGAQSNFLRGKVSLLLADACRGGGPT
NT seq 711 nt   +upstreamnt  +downstreamnt
atgcggagctggatatggggagattggacccctttcacagagcacagggagaacccaggt
gtccgggcctccatcacaacccaccccaggctccaggccagaccggggggacaaccccag
catccgggctcccgccctccccactccccctgccagagaagccaggcgtccggaccagcc
ccggaagacttagggctctggactctgctgtcgatgctgctgctgatgccggggccagtt
caggcaggcgccccccggcccatgtgcgacccccgtgtgctggagatgttcatccgcgaa
acccaggatgcagagaaggcagcagctgcctgcggagctgcgtgcgacctgccggacatc
ctgatgctgcctgaaacaaaagtgaactttaatgagtggcagcaaatgagttggccagcg
cgggtgcaggaggtgtgggggggtcataccctcctggttactgccctctgccgtgcccgg
gagctggtgactgagccggggacacgggtgacgctggagcggatgcacaacgtggtgcgc
ggcgtgggccagatcctgcgcaaccatgaggccaagcccccacccctggccccgccccca
ggcagccctgcccgctctgtgctccgcctcctgggggctcagtccaacttcctgcggggc
aaagtctcactcttgctggccgatgcctgccgggggggcggacctacgtga

DBGET integrated database retrieval system