KEGG   Alligator mississippiensis (American alligator): 106739102Help
Entry
106739102         CDS       T03087                                 

Definition
(RefSeq) pancreatic alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00500  Starch and sucrose metabolism
amj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106739102
Enzymes [BR:amj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     106739102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 106739102
NCBI-ProteinID: XP_019356416
LinkDB All DBs
Position
Un
AA seq 505 aa AA seqDB search
MKILLVLAAVGLCWAQYNPHTKPGRTSIVHLFEWRWADIALECERYLGPNGFGGVQISPP
SENIIITNPWRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVHIYVDAVVNHMCGA
GAGSGSGGTCGSYFNAQTEDFPAVPFSGWDFNDGKCKTGSGEIENYNDPYQVRDCRLVSL
LDLALEKDYVRSKIAEYMNYLIDIGVAGFRIDASKHMWPGDMKAFLDKLKNLNTQWFSSG
SKPFIYQEVIDLGGEPIKSSEYFGNGRVTEXXXXXXXXXLFHCLLRNWGEGWGLMPSDKA
LVFVDNHDNQRGHGAGGASVLTFWDPRQYKMATGFMLAHPYGFTRVMSSFWWPRDFQNGK
DINDWVGPPSFEDGTTKPVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFSNWWD
NNSNQVAFGRGNKGFIVFNNDDWYMNINLNTGLPAGTYCDVISGQKEGNHCTGIQVHIGA
DGVANFQISNQAEDPFIAIHVDAKL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccttcttgtgcttgcagctgtgggactttgctgggcacagtacaatccacat
acaaagcctgggaggacttctattgtccacctatttgaatggcgctgggctgatattgct
cttgaatgtgaacgctatttaggacctaatggattcggtggagttcagatatctcctcca
agtgaaaatattataattactaacccttggagaccctggtgggaaagataccaaccagtc
agctacaagctgtgcacacgatctggtaatgaggatgaatttcgaaacatggtgaccaga
tgcaacaatgttggagttcatatttatgtggatgctgtagtcaaccacatgtgcggagct
ggtgctggctctggcagtggaggtacttgtggaagctatttcaatgcacagactgaagat
tttcctgctgtgccattttcaggctgggattttaatgatggcaaatgtaaaactggaagt
ggagaaattgaaaattacaatgatccttatcaggtccgtgactgccgcttggttagtctt
cttgatcttgctctggagaaagactacgtgcgctcgaaaattgctgaatacatgaactac
cttattgatattggtgtagcaggcttcagaattgatgcctccaaacatatgtggcctggg
gacatgaaggcatttttagacaaactgaaaaatctaaatactcaatggttttcttcagga
tcaaaaccttttatttatcaggaggtaattgacttaggtggagaaccaatcaaaagcagc
gagtactttggaaatggccgagtgacggaannnnnnnnnnnnnnnnnnnnnnnnnaactc
ttccattgtttgcttaggaactggggagaaggctggggacttatgccttctgataaagca
cttgtctttgtggataatcatgacaaccagagaggacatggtgcaggtggagcctctgtt
ttaactttctgggatcccagacaatataaaatggcaacgggcttcatgcttgcccatcct
tatggatttacacgtgtgatgtcaagtttttggtggcccagggatttccagaatggaaag
gatattaatgattgggtgggaccaccaagctttgaggatggaacaaccaaacctgttaca
attaatccagataccacttgtggaaatgactgggtctgtgaacatagatggcgccaaata
aggaacatggttattttccgaaatgtggttgatggacaacctttctccaactggtgggac
aataatagcaatcaagtggcctttggacgtggaaataaaggattcattgtcttcaataat
gatgactggtacatgaatatcaatttgaacactggccttcctgctggaacttactgtgat
gttatttctgggcaaaaggaagggaaccactgtactggaatacaagtgcacattggtgct
gatggagttgctaatttccaaattagcaaccaggctgaagatccattcattgcaattcat
gtagatgctaaattgtaa

DBGET integrated database retrieval system