KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_00300Help
Entry
AMBLS11_00300     CDS       T02260                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00260  Glycine, serine and threonine metabolism
amk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMBLS11_00300 (tdh)
Enzymes [BR:amk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     AMBLS11_00300 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like Pyr_redox_3 Methyltransf_25 AdoHcyase_NAD 2-Hacid_dh_C FAD_oxidored FAD_binding_2 Pyr_redox_2 Pyr_redox UDPG_MGDP_dh_N PALP TrkA_N Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AFT76654
UniProt: K0CT50
LinkDB All DBs
Position
71273..72298
Genome map
AA seq 341 aa AA seqDB search
MKSLVKAKAEKGIWLQDTPEPEVGHNDLLIKIRKTAICGTDMHIYNWDEWSQKTIPVPMV
VGHEYVGEVVGMGQEVKGFKVGDRVSGEGHITCGHCRNCRAGRVHLCRNTEGVGVNRPGA
FAEYLVIPAFNAFKIPDNISDELASIFDPFGNAVHTALSFDLVGEDVLITGAGPIGIMAA
AVAKHVGARHVVVTDINPYRLELAKKMGATRVVDVSKEDLKDVMNELGMTEGFDVGLEMS
GVPAAFRDMLNKMNHGGKIAMLGIPPQDVAIDWNQVIFKGLVIKGIYGREMFETWYKMAS
LLQSGLDLSPIITHTFSIDDFQKGFDTMGSGHSGKVILDWQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgctagttaaagcgaaagcagaaaaaggcatttggttacaagacacgccagag
cctgaagtaggacacaatgacctactgattaaaattcgcaaaaccgctatttgcggcacc
gacatgcacatttacaactgggacgaatggtcacaaaaaactattcctgttcctatggtt
gtgggccacgaatatgtgggcgaagttgtaggtatgggccaagaagtaaaaggttttaaa
gttggtgaccgtgtttcaggcgaaggccatattacctgtggtcactgccgtaactgtcgc
gcaggccgagtacatttgtgccgtaacaccgagggtgttggcgtaaatcgccctggtgcg
tttgctgaatacttggttattcctgcttttaacgctttcaaaattccagacaacatcagt
gatgaactagcctctatctttgacccgtttggcaacgctgttcacaccgcactaagtttc
gacttggtaggtgaagacgtcctgataacaggtgctggcccaataggtattatggctgct
gctgttgcgaagcatgtaggtgctcgtcatgtcgtggttaccgacattaacccttaccgt
cttgagcttgctaaaaaaatgggtgcaacccgcgttgttgacgtaagcaaggaagatttg
aaagacgtaatgaacgaactgggtatgacagaaggcttcgatgtgggtctggaaatgtct
ggtgtacctgcggctttcagagacatgctgaacaaaatgaaccatggtggcaaaattgcc
atgctaggcattcctccgcaagacgttgctatcgattggaaccaagttattttcaaaggt
ttggtgataaaaggtatctacggccgtgaaatgttcgaaacatggtacaaaatggcgagt
ttgctgcaaagtggcttagatctatcgcctatcattactcacaccttttctattgatgac
tttcagaaagggtttgataccatggggtctggacactcaggtaaagttattctggattgg
caataa

DBGET integrated database retrieval system