KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_08145Help
Entry
AMBLS11_08145     CDS       T02260                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
amk  Alteromonas macleodii Black Sea 11
Brite
KEGG Orthology (KO) [BR:amk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AMBLS11_08145
Enzymes [BR:amk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AMBLS11_08145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like FAD_binding_2 GIDA DAO FAD_oxidored Lycopene_cycl Thi4 AlaDh_PNT_C Thioredoxin_9 NAD_binding_8 ABC_transp_aux Thioredoxin_4 Glutaredoxin K_oxygenase 3HCDH_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFT78210
UniProt: K0D0H8
LinkDB All DBs
Position
1933802..1935391
Genome map
AA seq 529 aa AA seqDB search
MLTKEILQALKSYAESMQKNVTFVVQTGEHSKREELVKFLSDIASVSDKLNVEERDTNGE
LRSAISFLLEADGEDTGIRFSGIPGGHEFNSLVLAMLHAAGTELKLDDSVKSMVKAVNEP
LNFEVFISLSCHNCPEVVQALNQFALINPNIKTEMIDGGLYQNLIQERDIQGVPSVYLNG
ELFANGKVDASVLINKLIERDPSLKEANKGDALPLQDVTVIGGGPAGVASAIYSARKGLK
VAIVAETFGGQVKDTMGIENLISVPKTTGPELVGNLMEHVRDYEITLKEHVRVESIEKGN
IKTITLSSGEQIRTRTVIVATGARWRELGVPGEKENIGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVTVFEFMPELKADKVLIDQAVKRDNITIIKNAATRQITAEN
GKVNAIEYQDRSTNEVHTRELAGVFVQIGLVPNSQFMKGTVDMTQYGEIIVDTKCHTSEP
GIFAAGDVTTVPYKQIVISMGEGAKASLAAFEYLLSHEVVESDEESEAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaactaaagaaattttacaagcattgaaatcatatgctgaatcaatgcagaaaaac
gtaacctttgtcgtacagaccggtgaacatagcaagcgtgaagagcttgtgaagtttctg
tccgacattgcttcagtaagcgacaaattaaatgtagaagagcgtgatactaatggtgaa
ttgcgcagtgcaatcagctttttattagaagctgacggtgaagatacgggaattcgtttt
tctggtatccctggcggccatgagttcaactctcttgtactagccatgctgcatgcagca
ggtactgaacttaagctagatgatagcgttaagtcgatggtgaaagcagtaaatgaacct
cttaactttgaagtcttcattagcttgagctgtcacaactgcccagaagtcgtacaggca
cttaatcaatttgctttgattaaccctaatatcaagaccgaaatgatcgacggtgggcta
tatcaaaacctaattcaagagcgcgacattcaaggtgtgcctagcgtatacctgaatggc
gagctgttcgcgaacggtaaagttgatgcttctgtgcttatcaacaaattaatcgaacgc
gaccctagccttaaagaagcgaataaaggcgatgcactaccgcttcaagacgtaactgtt
atcggtggtggtccagcaggtgtagcttcggcgatttacagtgcgcgtaaggggcttaaa
gtagcaattgttgctgaaacctttggcggccaagttaaggataccatgggtatcgagaac
cttatctctgtacctaagacaaccggtcctgagttggtaggcaacttgatggaacatgtg
cgcgattacgaaatcactcttaaagagcacgtgcgtgttgaaagcattgagaaaggtaac
atcaaaacaattacactttcttctggcgagcaaattcgcactcgcacggttatcgtagca
acaggtgcacgttggagagagcttggtgtaccaggcgagaaagaaaacattggtaatggt
gtggcgtattgcccacactgtgacggacctttcttcaaaggtaaggacgtagcggtaatt
ggcggtggcaactcaggtattgaagcggcacttgaccttgcaggcatcgtaaaatcggtg
acggtatttgaatttatgccagaacttaaggctgataaggttcttatcgaccaagctgtt
aaacgggataatattaccattatcaaaaatgcggcgacgcgccaaattacggcagaaaat
ggcaaagtgaacgctattgaataccaagaccgttcaactaacgaagtgcacacccgtgaa
cttgcaggtgtatttgttcaaattggactagtacctaacagtcagtttatgaagggcacg
gtagacatgacgcagtatggcgaaattatcgttgatactaagtgtcatacatctgagccg
ggtatatttgcagccggtgacgtaacaacagtaccatataagcagattgttatttcaatg
ggtgagggcgcaaaagcatcgcttgctgcatttgaatatttattaagtcacgaagtagtt
gaatcagacgaagaaagtgaagcagcttaa

DBGET integrated database retrieval system