KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_14030Help
Entry
AMBLS11_14030     CDS       T02260                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00473  D-Alanine metabolism
amk00550  Peptidoglycan biosynthesis
amk01100  Metabolic pathways
amk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:amk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AMBLS11_14030
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AMBLS11_14030
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AMBLS11_14030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:amk01011]
    AMBLS11_14030
Enzymes [BR:amk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AMBLS11_14030
Peptidoglycan biosynthesis and degradation proteins [BR:amk01011]
 Precursor biosynthesis
  Amino acid ligase
   AMBLS11_14030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_ST GARS_A ATP-grasp_3 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AFT79375
UniProt: K0D3X0
LinkDB All DBs
Position
complement(3294846..3295829)
Genome map
AA seq 327 aa AA seqDB search
MSKPSVGMHSQKTHSPDEYGKVAVLLGGDSAEREVSLNSGNAVLNALLRQGVDAFAFDPA
ERPLTDLLDLNVDRALIMLHGRGGEDGSMQGALQLLKIPYTGSRVLGSALAMDKIHTKQV
WQSLGLPTAKYEIADKRHFEAGKCSAIMDKLGNEVMVKPAREGSSIGMARVTSAKQLETA
IQDAFKYDNQVLLEQYIDGPEFTVSVLQGQALPSIRMSTPHTFYDYAAKYQDNTTEYYCP
SGLSEEQEAQLAKLASRAFDAISGSGWGRIDVMQDNQRQFYLLEANTVPGMTEKSLVPKA
AKVAGLTFDELVLSILSTSFDDVANKA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccttcagtaggtatgcattctcaaaaaacacactctcctgacgagtatgga
aaagttgctgtactgcttggcggcgattctgctgagcgcgaagtatcgcttaattcgggc
aatgcggtgttaaacgcgctgttgagacaaggcgtggatgcgtttgcgtttgatccagca
gagcgaccgcttaccgatcttctcgacctaaacgttgatagagcactaattatgctacac
ggtcgtggtggtgaagatggctctatgcaaggagctcttcagctactgaaaatcccctat
accggaagtcgagttttaggttctgcactggcaatggacaaaattcatactaagcaagtg
tggcaaagtttaggcttacccactgcaaaatatgaaattgctgataaaaggcactttgaa
gctggtaagtgcagcgctataatggataaattggggaatgaagtcatggtaaaaccggcc
agagaagggtcgagtattggcatggcaagagtgacaagcgctaaacagctcgaaactgcc
attcaggacgcctttaaatacgataatcaagtcctgttagagcagtacatagatggcccc
gagttcactgtttctgtattgcagggacaggcgttgccgtctattcgcatgtctactcca
catacattctatgattatgctgcgaaatatcaggataatacaacagaatactattgccca
agcggcttgtctgaagagcaagaagcacagctagcaaaactagcatctcgtgcttttgac
gctatttctggcagcggctggggtagaattgacgtcatgcaggacaaccaaaggcaattt
tatttgctagaggcgaacacagtgcctggtatgacagaaaaaagtttggtgccgaaggca
gccaaagttgcaggactaacatttgacgaactggtactaagtattctttctactagtttc
gatgacgttgcaaacaaggcgtaa

DBGET integrated database retrieval system