KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_17190Help
Entry
AMBLS11_17190     CDS       T02260                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk03030  DNA replication
amk03410  Base excision repair
amk03420  Nucleotide excision repair
amk03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:amk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AMBLS11_17190
   03410 Base excision repair
    AMBLS11_17190
   03420 Nucleotide excision repair
    AMBLS11_17190
   03430 Mismatch repair
    AMBLS11_17190
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:amk03032]
    AMBLS11_17190
   03400 DNA repair and recombination proteins [BR:amk03400]
    AMBLS11_17190
Enzymes [BR:amk01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AMBLS11_17190
    6.5.1.6  DNA ligase (ATP or NAD+)
     AMBLS11_17190
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AMBLS11_17190
DNA replication proteins [BR:amk03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AMBLS11_17190
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AMBLS11_17190
DNA repair and recombination proteins [BR:amk03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AMBLS11_17190
   NER (nucleotide excision repair)
    Other NER factors
     AMBLS11_17190
   MMR (mismatch exicision repair)
    Other MMR factors
     AMBLS11_17190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_A_N Peptidase_M75 NEMO
Motif
Other DBs
NCBI-ProteinID: AFT80005
UniProt: K0D5G3
LinkDB All DBs
Position
4052813..4054483
Genome map
AA seq 556 aa AA seqDB search
MEEFSNLLEQLYYTAGTKAKAQLIADYIANTPAPDRGWAIAAMAGTLRFDFFKRNTVKKL
ITEHTDPALFAMSYDYVGEVSETVAHLWPYSEPVDKLPSLTEVVETFASVSKQKVSKTLA
NYLTMMTPAQRWALLKLGTRGLRIGVSARSIKQILADYGNKDIKEIETLWHAVTPPYSEM
LAWLEGDADKPNIENAVTFHPVMLSHPIENSDIDAFEENTWQIENKYDGIRVQLAVKSER
SVGNKAAKKNTSQSSDDDTPDKALFSRTGDDISHSFPDLLETVDGNMVLDGELLVIDNIE
DEPYSTDTSQPDVGTFNALQQRLNKKKPSKALQASAPVGLIVYDALVLDGEDLTEKTLKE
RRHALNEWFNHNKSERLFLSETLSATSPESLRELHANVCKNRAVEGLMIKHLESKYIPGR
PKGQWFKWKRDPLVVDAVMMYAQRGHGKRSSFYSDYTFGAWEDNQLLPIGKAYSGFTDEE
LKKLDNWVRRNAVGRFGPVREVKKELVLEVAFDAVHPSSRHKSGVALRFPRIHRIRWDKP
ATEADTLANVKALIES
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggaggaattcagtaacctgcttgagcagctttactatacagcgggaactaaagccaaa
gcgcaactcattgccgattacattgccaacacgcctgctcctgaccgaggctgggccatt
gctgctatggcagggacattgcgttttgatttttttaaacgcaacacagtaaaaaaactt
attaccgaacacaccgaccctgctctctttgcaatgagctacgattatgtaggcgaagtc
agcgaaaccgtggcgcatttgtggccttacagtgagcctgtagacaaacttcccagtctt
actgaagtagtagaaacctttgcatctgtaagcaagcaaaaggtgtcgaagacgctagcc
aattatttaacgatgatgacacctgcgcagcgctgggctttattaaaacttggtacgcgg
ggcttgcgcataggcgtgtcagctcgttccattaagcaaatattggccgattatggcaat
aaagatatcaaagaaattgagacgctgtggcatgcggttacaccaccctattcagagatg
cttgcttggttagaaggcgacgctgacaaacctaatattgaaaatgcggttacctttcac
cccgtgatgctttcacaccctatcgagaacagcgatattgatgccttcgaggaaaacacg
tggcaaattgaaaataagtacgacggcattcgagtacagcttgctgttaaatcagaaagg
tctgtaggtaataaagccgctaaaaaaaatacctctcagtcttcggatgacgatacgcca
gataaagcgcttttctcgcgtacaggggatgacattagccattcttttcccgatctacta
gagacggtagacggaaatatggtgttagacggtgagctgctggttattgataacattgag
gatgagccttatagcaccgatacttcacaacccgatgtcggcacctttaacgcactgcag
caacgcctcaataagaaaaagccgagcaaagcactgcaagcatctgcacctgtcgggctt
attgtttacgatgccctagtgttagatggcgaagatttaactgagaaaacattgaaggaa
cgtcgccacgctctcaacgaatggtttaaccacaataagagcgagcgcttatttttatca
gaaaccctttcggcaacctctcctgaaagccttcgagaactacacgccaacgtttgtaaa
aatcgtgcggtagaagggctgatgataaagcacttagaaagtaagtacattcccggtcgt
cccaaagggcaatggttcaagtggaagcgcgacccgctggtggtagacgcggtaatgatg
tacgcacagcgcgggcacggcaagcgctcaagcttttattccgattacacattcggcgca
tgggaagacaaccagcttttgccaattggaaaagcgtattctggatttaccgacgaagaa
cttaagaagctagacaactgggtaagacgaaatgcagtaggtcgctttggccctgtgcga
gaggtaaagaaagagctcgtattagaagtggctttcgacgctgtacacccatcctccaga
cataaatcaggtgtggcattgcgctttccccgtattcaccgtattcgctgggacaagccc
gcaactgaggctgacacactagccaacgttaaagctttaatagaaagttaa

DBGET integrated database retrieval system