Ailuropoda melanoleuca (giant panda): 100462659 Help Entry 100462659         CDS       T01329                                  Gene name IFNG Definition (RefSeq) interferon gamma precursor   KO K04687   interferon gamma Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml03050   Proteasome aml04060   Cytokine-cytokine receptor interaction aml04066   HIF-1 signaling pathway aml04217   Necroptosis aml04350   TGF-beta signaling pathway aml04380   Osteoclast differentiation aml04612   Antigen processing and presentation aml04630   JAK-STAT signaling pathway aml04650   Natural killer cell mediated cytotoxicity aml04657   IL-17 signaling pathway aml04658   Th1 and Th2 cell differentiation aml04659   Th17 cell differentiation aml04660   T cell receptor signaling pathway aml04940   Type I diabetes mellitus aml05140   Leishmaniasis aml05142   Chagas disease aml05143   African trypanosomiasis aml05144   Malaria aml05145   Toxoplasmosis aml05146   Amoebiasis aml05152   Tuberculosis aml05160   Hepatitis C aml05164   Influenza A aml05168   Herpes simplex virus 1 infection aml05200   Pathways in cancer aml05235   PD-L1 expression and PD-1 checkpoint pathway in cancer aml05321   Inflammatory bowel disease aml05322   Systemic lupus erythematosus aml05323   Rheumatoid arthritis aml05330   Allograft rejection aml05332   Graft-versus-host disease aml05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     100462659 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     100462659 (IFNG)    04630 JAK-STAT signaling pathway     100462659 (IFNG)    04066 HIF-1 signaling pathway     100462659 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100462659 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100462659 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     100462659 (IFNG)    04612 Antigen processing and presentation     100462659 (IFNG)    04660 T cell receptor signaling pathway     100462659 (IFNG)    04658 Th1 and Th2 cell differentiation     100462659 (IFNG)    04659 Th17 cell differentiation     100462659 (IFNG)    04657 IL-17 signaling pathway     100462659 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     100462659 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100462659 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100462659 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     100462659 (IFNG)    05323 Rheumatoid arthritis     100462659 (IFNG)    05321 Inflammatory bowel disease     100462659 (IFNG)    05330 Allograft rejection     100462659 (IFNG)    05332 Graft-versus-host disease     100462659 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100462659 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100462659 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     100462659 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     100462659 (IFNG)    05164 Influenza A     100462659 (IFNG)    05168 Herpes simplex virus 1 infection     100462659 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     100462659 (IFNG)    05144 Malaria     100462659 (IFNG)    05145 Toxoplasmosis     100462659 (IFNG)    05140 Leishmaniasis     100462659 (IFNG)    05142 Chagas disease     100462659 (IFNG)    05143 African trypanosomiasis     100462659 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:aml03051]     100462659 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:aml04052]     100462659 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:aml00536]     100462659 (IFNG) Proteasome [BR:aml03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     100462659 (IFNG) Cytokines and growth factors [BR:aml04052]  Cytokines   Interferons    100462659 (IFNG) Glycosaminoglycan binding proteins [BR:aml00536]  Heparan sulfate / Heparin   Cytokines    100462659 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma Motif Other DBs NCBI-GeneID:  100462659 NCBI-ProteinID:  NP_001291792 Ensembl:  ENSAMEG00000008725 UniProt:  C8CBV8 LinkDB All DBs AA seq 166 aa AA seqDB search MNYTSYILAFQLCVILCSSGYYCQAMFFKEIENLKEYFNASNPDVADGGPLFLDILKNWR EESDKTIIQSQIVSFYLKLFENFKDNQIIQRSMDTIKEDMLFKFFNSSTSKRSDFLKLIQ IPVNDMQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaattatacaagctatatcttagctttccagctttgcgtgattttgtgttcttcaggc tattactgtcaggccatgttttttaaagaaatagaaaacctgaaggaatattttaatgca agtaatccagatgtagcggatggtggccctcttttcttagatattttgaagaactggaga gaggagagtgacaaaacgatcattcaaagccaaatcgtctccttctacttgaaactgttt gaaaactttaaagataaccagatcattcaaaggagcatggataccatcaaggaagacatg cttttcaagttcttcaacagcagtaccagtaagcggagtgacttccttaagctgattcaa attcccgtgaatgatatgcaggttcagcgcaaagcgataaatgaactcatcaaagtgatg aatgatctctcaccaagatctaacctgaggaagcggaaaaggagtcagaatctgtttcga ggccgcagagcatcgaaataa

DBGET integrated database retrieval system