KEGG   Ailuropoda melanoleuca (giant panda): 100463588Help
Entry
100463588         CDS       T01329                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00250  Alanine, aspartate and glutamate metabolism
aml00410  beta-Alanine metabolism
aml00430  Taurine and hypotaurine metabolism
aml00650  Butanoate metabolism
aml01100  Metabolic pathways
aml04727  GABAergic synapse
aml04940  Type I diabetes mellitus
Module
aml_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100463588 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100463588 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100463588 (GAD1)
   00430 Taurine and hypotaurine metabolism
    100463588 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100463588 (GAD1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100463588 (GAD1)
Enzymes [BR:aml01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100463588 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 SepSecS OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 100463588
NCBI-ProteinID: XP_011228951
Ensembl: ENSAMEG00000008765
LinkDB All DBs
Position
Un
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDGHFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKFFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGSA
LGFGTDNVILIKCNERGKIIPADLEAKILDAKQKGFVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGIPDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccttcttcgtccgcaacctcctcgaatgcgggagcggaccccaat
actaccaacctgcgccccacaacgtacgacacctggtgcggcgtggcccatggatgcacc
agaaaactggggctcaagatctgcggcttcttgcaaaggaccaacagcctggaagagaag
agccggcttgtgagcgccttcaaggagaggcaatcctccaagaacctgctttcctgtgaa
aacagtgacagggatggccatttccggcgcacggagaccgacttctccaatctgtttgct
cgagatctgcttccggctaagaatggggaggagcagaccgtgcagttcctactggaagtg
gtagacatactcctcaactatgtccgcaagacctttgatcgctccaccaaggtgctggac
ttccatcacccgcaccagctgctggaaggcatggagggcttcaacttggagctgtcggac
caccccgagtccctggagcagatcttggttgactgcagagacaccttgaagtacggggtc
cgtacaggtcatcctcgatttttcaaccagctctccactggattggatatcattggttta
gctggcgaatggctgacatcaactgccaataccaatatgtttacatatgaaatcgcacca
gtatttgtcctcatggagcaaataacacttaaaaagatgagagagatagttggatggtca
agtaaagacggtgatgggatattttctcctgggggagccatctccaacatgtacagcatc
atggctgctcgctacaagttcttcccggaagttaagacaaagggcatggcggctgttccc
aaactggtcctcttcacctcagaacacagtcactattccataaagaaggctggatctgca
cttggctttggaactgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
ccagctgatttagaggcaaaaattcttgatgccaagcaaaagggattcgttcccctgtat
gtcaatgcaactgcgggcacgacggtgtatggagctttcgatccaatccaggagattgca
gatatatgtgagaaatataacctatggctacatgtcgacgctgcctggggcggcgggctg
ctcatgtccaggaagcaccgccacaaactcagtggcatagaaagggccaactcagtcacc
tggaaccctcacaagatgatgggtgtgctattgcagtgctctgccattctcgtcaaggaa
aagggtatactccagggatgcaaccagatgtgtgccgggtaccttttccagccagacaag
cagtatgatgtctcctatgacactggggacaaggcaatccagtgtggccgccatgtggac
attttcaagttctggctgatgtggaaagcaaagggcacagtgggatttgaaaatcagatc
aacaaatgcttggaactggctgaatacctctatgccaagattaaaaacagagaagaattt
gagatggtttttgatggtgagcctgaacatacaaacgtttgtttctggtatattccacaa
agcctcaggggcattccggatagccctgaacgacgggaaaaactacacagggtggccccc
aaaatcaaagcactgatgatggagtctggcacgaccatggttggctaccagcctcagggg
gacaaggccaactttttccggatggtcatctcgaacccagccgctacgcagtctgatatt
gacttcctcattgaggagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system