KEGG   Ailuropoda melanoleuca (giant panda): 100463656
Entry
100463656         CDS       T01329                                 

Gene name
PRKAB1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04371  Apelin signaling pathway
aml04530  Tight junction
aml04710  Circadian rhythm
aml04714  Thermogenesis
aml04910  Insulin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100463656 (PRKAB1)
   04068 FoxO signaling pathway
    100463656 (PRKAB1)
   04152 AMPK signaling pathway
    100463656 (PRKAB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100463656 (PRKAB1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100463656 (PRKAB1)
   04922 Glucagon signaling pathway
    100463656 (PRKAB1)
   04920 Adipocytokine signaling pathway
    100463656 (PRKAB1)
   04921 Oxytocin signaling pathway
    100463656 (PRKAB1)
  09149 Aging
   04211 Longevity regulating pathway
    100463656 (PRKAB1)
   04213 Longevity regulating pathway - multiple species
    100463656 (PRKAB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100463656 (PRKAB1)
   04714 Thermogenesis
    100463656 (PRKAB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100463656 (PRKAB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100463656 (PRKAB1)
   04931 Insulin resistance
    100463656 (PRKAB1)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 DUF4758
Other DBs
NCBI-GeneID: 100463656
NCBI-ProteinID: XP_034528251
Ensembl: ENSAMEG00000016023
LinkDB
Position
12
AA seq 270 aa
MGNTSSERAALERQGGHKTPRRDSSGGAKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPVVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggcaacacgagcagcgagcgggccgcgctggagcggcagggcggccacaagacgccg
cgaagggacagctcggggggcgccaaggatggggacaggcccaagatcctgatggacagc
cccgaggacgccgacctcttccactccgaggaaatcaaggctccagagaaggaagaattc
ctggcttggcagcatgatctggaagtgaatgataaagcccctgcccaggctcggccaaca
gtgtttcgatggacggggggtggaaaggaagtttacttatctgggtccttcaacaactgg
agtaaacttcccctcacgagaagccacaataactttgtagccatcctggacctgcccgaa
ggagagcatcagtacaagttctttgtggatggtcagtggacgcatgacccttctgagcca
gtagtaaccagccagcttggcacagttaacaacatcattcaagtgaagaaaactgacttt
gaagtatttgatgctttaatggtggattcccaaaagtgctccgatgtgtctgagctatcc
agctccccaccgggaccttaccatcaggagccgtatgtctcaaagccagaagaacggttt
aaagccccccccattctccctccacatctgctccaggtcatcctgaacaaggacacgggg
atttcttgtgatccagctttgctccctgagcccaaccacgtcatgttgaaccacctttac
gcgctctccatcaaggatggagtgatggtgctcagcgcgacccaccgatacaagaaaaag
tatgtcaccaccttgttatacaagcccatatga

KEGG   Ailuropoda melanoleuca (giant panda): 100468143
Entry
100468143         CDS       T01329                                 

Gene name
PRKAG3
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-3 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04371  Apelin signaling pathway
aml04530  Tight junction
aml04710  Circadian rhythm
aml04714  Thermogenesis
aml04910  Insulin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100468143 (PRKAG3)
   04068 FoxO signaling pathway
    100468143 (PRKAG3)
   04152 AMPK signaling pathway
    100468143 (PRKAG3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100468143 (PRKAG3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100468143 (PRKAG3)
   04922 Glucagon signaling pathway
    100468143 (PRKAG3)
   04920 Adipocytokine signaling pathway
    100468143 (PRKAG3)
   04921 Oxytocin signaling pathway
    100468143 (PRKAG3)
  09149 Aging
   04211 Longevity regulating pathway
    100468143 (PRKAG3)
   04213 Longevity regulating pathway - multiple species
    100468143 (PRKAG3)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100468143 (PRKAG3)
   04714 Thermogenesis
    100468143 (PRKAG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100468143 (PRKAG3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100468143 (PRKAG3)
   04931 Insulin resistance
    100468143 (PRKAG3)
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 100468143
NCBI-ProteinID: XP_019662817
Ensembl: ENSAMEG00000002676
LinkDB
Position
2
AA seq 518 aa
MHTHTRWEKRLPVVWECGTCSHPFGPSSPHRTHPGAAWGDLSLKAPFPLPEMSFLEQGEN
TPWPSPAMTTGSERSHGKQGAKASRWTRQEALKEGELPGLGEDPTDPQARPPAEYIGLEV
TFPKATHLSQAAPLAQVGSPPAEWDILPPDDAASASGSSTDDLELNMESPATAAWGYELG
MVEERPALCPSPWALFPRPGWDDELQKPGAQVYMHFMQEHTCYDAMATSSKLVIFDTTLE
IKKAFFALVANGIRAAPLWDSKKQSFVGMLTITDFILVLHRYYRSPLVQIYEIEEHKIET
WREIYLQGCFKPLVSISPNSSLFEAVYTLIKNRIHRLPVLDPVSGAVLHILTHKRLLKFL
HIFGSLLPQPSFLSRTIQDLGIGTFRDLAVVLDTAPILTALDIFVDRRVSALPVVNEAGQ
VVGLYSRFDVIHLAAQQTYNHLDVSVGEALRQRTLCLEGVLSCQPHESLGEVIDRIAREQ
VHRLVLVDENQHLLGVVSLSDILQALVLSPAGIDALGA
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgcacacgcacacgcggtgggaaaagaggctccctgtggtttgggaatgtgggacatgt
tcccaccccttcggaccttcttctccccacagaacccatcctggagccgcctggggggac
ctgagcctcaaggccccattcccccttccagagatgagcttcctagaacaaggagagaac
actccatggccatcaccggccatgaccactggctcagagagaagccatgggaaacagggg
gccaaggcctcgagatggacaaggcaggaggccttgaaggaaggggagctgccgggtctg
ggggaagatccaacagatccccaggccaggccacctgctgagtacatcgggctggaggtc
acattccccaaggccacacatttgtcccaagctgctcccttggcccaggtgggctcccca
cctgccgagtgggacattctcccccctgacgacgcagcctcagcctcgggctccagcaca
gatgatctggagctgaacatggagtccccagccacagcggcctgggggtatgagctgggc
atggtggaagagaggccggccctgtgcccctccccgtgggccctgtttcccaggccaggc
tgggacgatgagctgcagaagccgggggcccaggtctacatgcacttcatgcaggagcac
acctgctacgatgccatggcgaccagctccaagctggtcatcttcgacaccacgctggag
atcaagaaggccttctttgccctcgtggccaacggcatccgggcagcccctctgtgggac
agcaagaagcagagcttcgtggggatgcttaccatcacggatttcatcttggtgctgcac
cgttattacaggtccccgctggtgcagatctatgagattgaagaacataagattgagacc
tggagagagatctaccttcaaggctgcttcaagcccctggtctccatttctcccaacagc
agcctgtttgaagctgtctacaccctcatcaagaaccggatccaccgcctgccggtcctg
gacccggtctcgggcgccgtgctccacatccttacacacaagcgactgcttaagttcctg
catatctttggctccctgctgccccagccctccttcctctcccgcaccatccaagacctg
ggcatcggtacgttccgagacttggccgtggtgctggacacggcgcccatcctgacggca
ctggacatcttcgtggaccggcgcgtgtctgcgttgcctgtggtcaatgaagctggacag
gtcgtgggcctctactcccgctttgatgtgattcacctggctgcccagcaaacctacaac
cacctagacgttagtgtgggagaagcactgaggcagaggacactgtgtctggagggagtc
ctttcctgccagccccacgagagcctgggggaagtcatcgaccggattgcccgggagcag
gtacaccggctggtgctagtggacgagaaccagcatctcctgggtgtggtgtcactctcc
gacatccttcaggcgctggtgctcagccctgctggcatcgacgccctcggtgcctga

KEGG   Ailuropoda melanoleuca (giant panda): 100470115
Entry
100470115         CDS       T01329                                 

Gene name
PRKAA1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1 isoform X1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04371  Apelin signaling pathway
aml04530  Tight junction
aml04710  Circadian rhythm
aml04714  Thermogenesis
aml04910  Insulin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml05410  Hypertrophic cardiomyopathy
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100470115 (PRKAA1)
   04068 FoxO signaling pathway
    100470115 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    100470115 (PRKAA1)
   04152 AMPK signaling pathway
    100470115 (PRKAA1)
   04150 mTOR signaling pathway
    100470115 (PRKAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100470115 (PRKAA1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100470115 (PRKAA1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100470115 (PRKAA1)
   04922 Glucagon signaling pathway
    100470115 (PRKAA1)
   04920 Adipocytokine signaling pathway
    100470115 (PRKAA1)
   04921 Oxytocin signaling pathway
    100470115 (PRKAA1)
  09149 Aging
   04211 Longevity regulating pathway
    100470115 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    100470115 (PRKAA1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100470115 (PRKAA1)
   04714 Thermogenesis
    100470115 (PRKAA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100470115 (PRKAA1)
   05410 Hypertrophic cardiomyopathy
    100470115 (PRKAA1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100470115 (PRKAA1)
   04931 Insulin resistance
    100470115 (PRKAA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100470115 (PRKAA1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100470115 (PRKAA1)
   03029 Mitochondrial biogenesis [BR:aml03029]
    100470115 (PRKAA1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100470115 (PRKAA1)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100470115 (PRKAA1)
Membrane trafficking [BR:aml04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100470115 (PRKAA1)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100470115 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    100470115 (PRKAA1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like FTA2 Kdo APH
Other DBs
NCBI-GeneID: 100470115
NCBI-ProteinID: XP_002922656
Ensembl: ENSAMEG00000015425
UniProt: D2HJX7
LinkDB
Position
3
AA seq 574 aa
MRRLGSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RKSDVPGVVRTGSMKELDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAK
IADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPF
DDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPK
YLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIM
NEAKDFYLATSPPDSFLDDHHFTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA
KWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQV
DSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRNDSDAEAQGKSSEASLTSSV
TSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgcgcagactcggttcctggagaaagatggcgacagccgagaagcagaaacacgacggg
cgggtgaagatcggccactacatcctgggggacacccttggcgtcggcaccttcggcaaa
gtgaaggttggcaaacatgaattgactgggcataaagttgctgtgaagatactcaatcga
cagaagattcgaagccttgatgtggtaggaaaaattcgcagagaaattcagaacctcaag
cttttcaggcatcctcatataattaaactgtaccaggtcatcagtacaccatctgatatt
ttcatggtgatggaatatgtctcaggaggagagctatttgattatatctgtaaaaatgga
aggaaatctgatgtacctggagtagtaagaacaggctccatgaaggagctggatgaaaaa
gaaagtcggcgtctgtttcaacagatcctttctggtgtggattactgtcacaggcatatg
gtggtccatagagatttgaaacctgaaaatgtcctgcttgatgcacacatgaatgcaaag
atagctgattttggtctttcaaacatgatgtcagatggtgaatttttaagaacaagttgc
ggctcacccaactatgctgcaccagaagtaatttcaggaagattgtatgcaggtccagag
gtagatatatggagcagtggggttattctttatgctttattatgtggaacccttccattt
gatgatgatcatgtgccaactctttttaagaagatatgtgatgggatcttttatacccct
cagtatttaaatccgtctgtgattagccttttgaaacatatgctacaggtggatcccatg
aagagggccacaatcaaagatatcagggaacatgaatggtttaaacaagatcttccaaaa
tatctttttcccgaggatccatcatacagttcaaccatgattgacgatgaagccttaaaa
gaagtatgtgaaaaatttgagtgctcagaagaggaggttctgagctgcctttataacaga
aatcaccaggaccctttggcagttgcctaccacctcataatagataacaggagaataatg
aatgaggccaaagatttttacttggcgacaagcccacctgattcttttctcgatgatcac
cacttcactcggccccatcctgaaagagtaccattcttggttgctgaaacaccaagagca
cgccacaccctcgatgaattaaatccacagaaatccaaacaccaaggtgtaaggaaagca
aaatggcatttgggaattagaagtcaaagtcgaccgaatgatatcatggcagaagtttgt
agagcaattaaacagctggattatgaatggaaggttgtaaacccctattatttgcgtgtt
cgaaggaagaatcctgtgacaagtacatactccaaaatgagtctgcagttataccaagtg
gatagtagaacatacttactggatttccgtagtattgatgatgaaattactgaagccaaa
tcagggactgctactccacagagatcgggatcagtaagcaactatcgatcttgccaaagg
aatgattcagatgctgaggctcaaggaaaatcctcagaagcttctcttacctcatctgtg
acctcacttgactcttctcctgttgacttaacaccaagaccaggaagtcacacaatagaa
ttttttgagatgtgtgcgaatctaattaaaattcttgcacagtaa

KEGG   Ailuropoda melanoleuca (giant panda): 100474747
Entry
100474747         CDS       T01329                                 

Gene name
PRKAG1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04371  Apelin signaling pathway
aml04530  Tight junction
aml04710  Circadian rhythm
aml04714  Thermogenesis
aml04910  Insulin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100474747 (PRKAG1)
   04068 FoxO signaling pathway
    100474747 (PRKAG1)
   04152 AMPK signaling pathway
    100474747 (PRKAG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100474747 (PRKAG1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100474747 (PRKAG1)
   04922 Glucagon signaling pathway
    100474747 (PRKAG1)
   04920 Adipocytokine signaling pathway
    100474747 (PRKAG1)
   04921 Oxytocin signaling pathway
    100474747 (PRKAG1)
  09149 Aging
   04211 Longevity regulating pathway
    100474747 (PRKAG1)
   04213 Longevity regulating pathway - multiple species
    100474747 (PRKAG1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100474747 (PRKAG1)
   04714 Thermogenesis
    100474747 (PRKAG1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100474747 (PRKAG1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100474747 (PRKAG1)
   04931 Insulin resistance
    100474747 (PRKAG1)
SSDB
Motif
Pfam: CBS DRTGG Cbl_N3 DUF2497
Other DBs
NCBI-GeneID: 100474747
NCBI-ProteinID: XP_002927237
Ensembl: ENSAMEG00000006964
LinkDB
Position
16
AA seq 330 aa
METVTSSDSSPALENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFI
TEFPKPEFMSKSLEELQIGTYANIAVVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
YSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
VVVDENDVVKGIVSLSDILQALVLTGGEKP
NT seq 993 nt   +upstreamnt  +downstreamnt
atggagacggtcacttcttcagatagctccccagctctggaaaatgagcatcctcaggag
accccagaatccaacaatagtgtgtatacttccttcatgaagtctcatcgctgctatgac
ctgattcccacaagctccaaattggttgtatttgatacttccctgcaggtgaagaaggct
ttctttgctttggtgactaatggtgtacgggctgcccctttgtgggatagtaagaagcaa
agttttgtaggcatgctgaccatcactgatttcatcaatatcctgcatcgctactataaa
tcagcgttggtacaaatctatgagctggaagaacacaagatagaaacttggagagaggtg
tacctacaggactccttcaaaccacttgtctgcatttctcctaatgccagcttgtttgat
gctgtctcttcattaattcgaaacaagatccacaggctgccagttattgacccggaatca
ggcaacaccttgtacatcctcacccacaagcgcatcctcaagttcctcaaattgtttatc
actgagttccccaagccagagttcatgtctaagtctctggaagagctacagatcggcacc
tacgccaacattgctgtggtccgcaccaccacccctgtctatgtggctctgggcatcttt
gtacaacaccgagtctcagcactgccagtagtagatgagaaagggcgtgtggtggacatc
tactccaagtttgatgttatcaatctggcagcagaaaagacctacaacaacctagatgtg
tctgtgaccaaagccctgcaacatcgatcccattactttgagggtgtcctcaagtgctac
ctgcatgagactctggagaccatcatcaacaggctggtggaagcagaggttcaccgactt
gtagtggtagatgagaatgatgtggtcaaaggcattgtatcactgtctgacatcctgcag
gccctggtgctcacaggaggagagaagccctga

KEGG   Ailuropoda melanoleuca (giant panda): 100475764
Entry
100475764         CDS       T01329                                 

Gene name
PRKAB2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-2 isoform X2
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04371  Apelin signaling pathway
aml04530  Tight junction
aml04710  Circadian rhythm
aml04714  Thermogenesis
aml04910  Insulin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100475764 (PRKAB2)
   04068 FoxO signaling pathway
    100475764 (PRKAB2)
   04152 AMPK signaling pathway
    100475764 (PRKAB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100475764 (PRKAB2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100475764 (PRKAB2)
   04922 Glucagon signaling pathway
    100475764 (PRKAB2)
   04920 Adipocytokine signaling pathway
    100475764 (PRKAB2)
   04921 Oxytocin signaling pathway
    100475764 (PRKAB2)
  09149 Aging
   04211 Longevity regulating pathway
    100475764 (PRKAB2)
   04213 Longevity regulating pathway - multiple species
    100475764 (PRKAB2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100475764 (PRKAB2)
   04714 Thermogenesis
    100475764 (PRKAB2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100475764 (PRKAB2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100475764 (PRKAB2)
   04931 Insulin resistance
    100475764 (PRKAB2)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Other DBs
NCBI-GeneID: 100475764
NCBI-ProteinID: XP_002929606
Ensembl: ENSAMEG00000017027
UniProt: D2I2Z7
LinkDB
Position
2
AA seq 271 aa
MGNTSDRVAGERHGAKASRAEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVS
WQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEG
EHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDL
SSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHL
YALSIKDSVMVLSATHRYKKKYVTTLLYKPI
NT seq 816 nt   +upstreamnt  +downstreamnt
atgggaaacaccagcgaccgagtggctggcgagcgccacggcgccaaggcttcacgcgcc
gagggcgccggcggccatgcgccgggcaaggagcataagatcatggtggggagtaccgac
gaccctagcgtcttcagcctgccggactccaagctccctggggacaaagagtttgtatca
tggcagcaggatttggaggactccgtaaagcccacacagcaggcccggcccactgttatc
cgctggtctgaaggaggcaaggaggtcttcatctctgggtccttcaacaattggagcacc
aagattccactgattaagagccataatgactttgttgccatcttagacctccctgaggga
gagcaccagtacaagttctttgtggatggacagtgggttcatgatccgtcagagcctgtg
gttaccagtcagcttggcacgattaacaatttgatccatgtcaagaaatctgactttgag
gtgtttgatgctttaaagctagattcaatggaaagctcggagacatcttgtagagacctt
tccagctctcccccagggccttatggtcaagaaatgtatgtgtttcgatctgaggagaga
ttcaaatccccacccatcctacctcctcaccttcttcaagttattcttaacaaggacact
aatatttcttgtgatccagccttgcttcctgagcccaatcatgttatgctgaaccatctc
tatgcattatccattaaggacagtgtgatggtcctgagcgcaacccatcgttacaagaag
aagtatgttactactctgctgtacaagcccatctga

KEGG   Ailuropoda melanoleuca (giant panda): 100480315
Entry
100480315         CDS       T01329                                 

Gene name
PRKAG2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04371  Apelin signaling pathway
aml04530  Tight junction
aml04710  Circadian rhythm
aml04714  Thermogenesis
aml04910  Insulin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100480315 (PRKAG2)
   04068 FoxO signaling pathway
    100480315 (PRKAG2)
   04152 AMPK signaling pathway
    100480315 (PRKAG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100480315 (PRKAG2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100480315 (PRKAG2)
   04922 Glucagon signaling pathway
    100480315 (PRKAG2)
   04920 Adipocytokine signaling pathway
    100480315 (PRKAG2)
   04921 Oxytocin signaling pathway
    100480315 (PRKAG2)
  09149 Aging
   04211 Longevity regulating pathway
    100480315 (PRKAG2)
   04213 Longevity regulating pathway - multiple species
    100480315 (PRKAG2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100480315 (PRKAG2)
   04714 Thermogenesis
    100480315 (PRKAG2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100480315 (PRKAG2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100480315 (PRKAG2)
   04931 Insulin resistance
    100480315 (PRKAG2)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 100480315
NCBI-ProteinID: XP_034495647
Ensembl: ENSAMEG00000013406
LinkDB
Position
1
AA seq 308 aa
MRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTIT
DFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVNISPDASLFDAVYSLIKNK
IHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQNLDALGIGTYHNIAFIHP
DTPIIKALNVFVERRVSALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHR
SQYFEGVVKCSKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALILTPAGA
KQKEAEAE
NT seq 927 nt   +upstreamnt  +downstreamnt
atgcgcttcatgaggtcacacaagtgttacgacatcgttcccaccagttcaaagctagtg
gtgtttgatactacattacaagtgaaaaaggccttctttgccttagtagccaatggtgtt
cgagcagcgccactgtgggagagtaagaaacaaagttttgtaggaatgctaacaattaca
gacttcataaatatactacatagatactataagtcgcccatggtacagatttatgaatta
gaggaacataagattgaaacatggagggagctttatttacaagaaacatttaagccttta
gtgaatatatctccagatgcaagcctcttcgatgctgtatactcgttgatcaaaaataaa
atccacagattgccagttattgaccctatcagtgggaatgcactttatatacttacccac
aaaagaatcctcaagttcctccagctttttatgtctgatatgccaaagcctgccttcatg
aagcagaacctggatgcccttggaattgggacctaccacaacatcgccttcatccaccca
gacactcccatcatcaaagccttgaacgtctttgtagaaagacgagtgtcagccttgcct
gtggtggacgagtcaggaaaagtcgtagatatttattccaaatttgatgtaattaatctt
gctgctgaaaaaacctacaataacctagatatcacagtgacccaggcccttcagcaccgc
tcccagtatttcgagggtgtcgtgaagtgcagtaagctggaaatcctggagaccatcgtg
gaccggatagtgcgggctgaggtgcatcggctggtggtagtaaacgaagcagacagcatc
gtgggtattatctccctgtcggacattctgcaagccctgatactcacgcccgcaggtgcc
aaacagaaggaggcggaagcagaatga

KEGG   Ailuropoda melanoleuca (giant panda): 100481376
Entry
100481376         CDS       T01329                                 

Gene name
PRKAA2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2 isoform X1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04371  Apelin signaling pathway
aml04530  Tight junction
aml04710  Circadian rhythm
aml04714  Thermogenesis
aml04910  Insulin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml05410  Hypertrophic cardiomyopathy
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100481376 (PRKAA2)
   04068 FoxO signaling pathway
    100481376 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    100481376 (PRKAA2)
   04152 AMPK signaling pathway
    100481376 (PRKAA2)
   04150 mTOR signaling pathway
    100481376 (PRKAA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100481376 (PRKAA2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100481376 (PRKAA2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100481376 (PRKAA2)
   04922 Glucagon signaling pathway
    100481376 (PRKAA2)
   04920 Adipocytokine signaling pathway
    100481376 (PRKAA2)
   04921 Oxytocin signaling pathway
    100481376 (PRKAA2)
  09149 Aging
   04211 Longevity regulating pathway
    100481376 (PRKAA2)
   04213 Longevity regulating pathway - multiple species
    100481376 (PRKAA2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100481376 (PRKAA2)
   04714 Thermogenesis
    100481376 (PRKAA2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100481376 (PRKAA2)
   05410 Hypertrophic cardiomyopathy
    100481376 (PRKAA2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100481376 (PRKAA2)
   04931 Insulin resistance
    100481376 (PRKAA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100481376 (PRKAA2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100481376 (PRKAA2)
   03029 Mitochondrial biogenesis [BR:aml03029]
    100481376 (PRKAA2)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100481376 (PRKAA2)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100481376 (PRKAA2)
Membrane trafficking [BR:aml04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100481376 (PRKAA2)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100481376 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    100481376 (PRKAA2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 100481376
NCBI-ProteinID: XP_034509140
Ensembl: ENSAMEG00000017253
LinkDB
Position
2
AA seq 532 aa
MTASFFFFFSLVGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKLFRHPHIIKLY
QVISTPTDFFMVMEYVSGGELFDYICKHGRVEEVEARRLFQQILSAVDYCHRHMVVHRDL
KPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSC
GVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIK
DIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQL
AVAYHLIIDNRRIMNQASEFYLASSPPTGSFMDDSTMHIPPGLKPHPERMPPLIADSPKA
RCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRV
RRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRS
SFDSVTAESHSLSGSLTGSLTGSTLSSVPPRLGSHTMDFFEMCASLITTLAR
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgacagcaagttttttctttttcttttctttagttggagaacatcaattgacaggccat
aaagtggcagttaaaatcttaaatagacagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaacctaaaactctttcgtcatcctcatataatcaaactatac
caggtgatcagcactccaacagatttttttatggtgatggaatatgtgtctggtggtgaa
ttatttgactacatctgtaaacatggacgggttgaagaggtggaagcaaggcggctcttt
cagcagattctgtcagctgtggattactgtcataggcatatggtggttcatcgagacctg
aaaccagagaatgtgctgttggatgctcacatgaatgccaagatagctgattttggattg
tctaatatgatgtcagatggtgaatttctgcgaaccagttgtggatctccaaattatgca
gcacctgaagtcatctcaggcagattgtatgcaggtcctgaagttgatatctggagctgt
ggtgttattttgtatgcccttctttgtggcaccctcccatttgatgatgagcatgtacct
acgttatttaagaagatccgagggggtgttttttatatcccagaatatctcaatcgttct
gttgccactctcttgatgcatatgctgcaggttgaccccctgaaacgagcaaccatcaaa
gatataagagagcatgaatggtttaaacaagatttgcccagttacttatttcctgaagac
ccctcctatgatgctaacgtcattgatgatgaggctgtgaaagaagtgtgtgaaaaattt
gagtgtacagaatcagaagtaatgaacagtttatatagtggtgaccctcaagaccagctt
gcagtggcttatcatcttatcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctctagtcccccaacaggttcttttatggatgatagtaccatgcatattccc
ccaggcctgaaacctcatccagaacggatgccacctcttatagcagacagccctaaagcg
agatgtccattggatgcactgaacacaactaagcccaaatctttagctgtgaaaaaagcc
aagtggcatcttggaatcagaagtcaaagcaaaccgtatgacattatggctgaggtctac
cgagctatgaagcagctggattttgaatggaaggtagtgaatgcataccatcttcgtgta
agaaggaaaaatccagtgactggcaattatgtgaaaatgagcttacaactttacctggtt
gacaacagaagctatcttttggactttaaaagcattgatgatgaggtggtggagcagagg
tctggttcttcaacacctcagcgttcctgttctgctgctggcttacatagaccaagatca
agttttgattctgtaactgcagagagccattcactttctggctctctcactggctctttg
accggaagcacattgtcttcagttccaccccgcctaggcagtcacaccatggattttttt
gaaatgtgtgccagtctgatcactaccttagcccgttga

DBGET integrated database retrieval system