KEGG   Ailuropoda melanoleuca (giant panda): 100463875
Entry
100463875         CDS       T01329                                 

Gene name
RBL2
Definition
(RefSeq) retinoblastoma-like protein 2 isoform X1
  KO
K16332  retinoblastoma-like protein 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04151  PI3K-Akt signaling pathway
aml04218  Cellular senescence
aml05165  Human papillomavirus infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100463875 (RBL2)
   04151 PI3K-Akt signaling pathway
    100463875 (RBL2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100463875 (RBL2)
   04218 Cellular senescence
    100463875 (RBL2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100463875 (RBL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100463875 (RBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100463875 (RBL2)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    100463875 (RBL2)
SSDB
Motif
Pfam: RB_A RB_B DUF3452 TFIIB SLH
Other DBs
NCBI-GeneID: 100463875
NCBI-ProteinID: XP_019664303
Ensembl: ENSAMEG00000016277
LinkDB
Position
12
AA seq 1139 aa
MPSGGDQSPPPPPPPPAAAASDEEEEDDGEAEDAAQTARSPAPQTQQRFDELCSRLNMDE
AARAEAWDSYRNMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTVEGNYVSLTRILRC
SEQSLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEE
QPRQQRGRKQRRQPCTVSEVFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGNA
LQCSNRKELVNPNFKGLSEDFHAKDFKPSSDPPCVIEKLCSLHDGLVLEAKGIKEHFWKP
YIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDERIFLGEDAEE
EIGTLSRCLNSGSGTETAERVQMKNILQQHFDKSKALRISTPLTGVRYMKDNSPCVTPVS
TATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMYEIYSQHCQSDEDF
SNSKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVVT
FSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKP
ESPLWDRIRDNENRVPTCEEVMPPQNLERADDICIAGSPLTPRRVSEVRADTGGLGRSIT
SPATLYDRYSSPTASSTRRRLFVENDSPSDAGTPGRLPPQPLVNAVPVQNVSGDAVSVTP
VPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQTQAVTGSIQPLS
AQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGHQQKQGPPLTSSSIRPRKTSSLSLFFR
KVYHLAGVRLRDLCAKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIYVMAK
VTKEDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRKRRNSGSSDSRSHQNSPTELNKDRT
SRDSSPVMRSSSTLPVPQPSSAPPTPTRLTGANSDMEEEERGDLIQFYNNIYIKQIKTFA
MKYSQANVTDAPPLSPYPFVRTGSPRRIQLSQNHPVYISPHKNETMLSPREKIFYYFSNS
PSKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQDVANDRGSH
NT seq 3420 nt   +upstreamnt  +downstreamnt
atgccgtcgggaggcgaccagtcgccgccgcctccgcctcctcctccggcggcggcagcc
tcggacgaggaggaggaagacgacggggaggcggaggacgccgcgcagacggcccggtcg
ccggcccctcagacccagcagcggttcgacgagctgtgcagccgcctgaacatggacgag
gcggcgcgggcggaggcctgggacagctaccgcaacatgagcgagagctacacgctggag
ggaaatgatcttcattggttagcatgtgccttatatgtggcttgcagaaaatctgtgcca
actgtaagcaaagggacagttgaaggaaactatgtatctctgactagaatcctgcgatgt
tcagagcagagcttaattgaattttttaacaagatgaagaagtgggaagacatggcaaat
ctacccccacatttcagagaacgtactgagagattagaaagaaacttcactgtttcagca
gtaatttttaagaaatatgaacccatttttcaggacatttttaaatatcctcaagaggag
cagcctcgtcagcagagaggaagaaaacagcggcgacagccctgcaccgtgtccgaagtt
ttccatttttgttgggtgctctttatatatgcaaaaggtaatttccccatgattagtgat
gatttggtcaattcttatcatcttctgctgtgtgctttggacttggtttatggaaatgcc
cttcagtgttccaatcgtaaagaactggtaaaccctaattttaaaggcctgtctgaagat
tttcatgctaaggattttaaaccttcctccgacccaccttgtgtcattgaaaaactctgt
tccttacatgatggcctcgttttggaagcaaagggaataaaagaacatttctggaaaccc
tatattaggaaactttatgaaaaaaagctccttaagggaaaagaagaaaatcttacgggg
tttttagaacctgggaattttggagagagttttaaagccatcaataaggcctatgaggag
tatgtgttatctgttgggaatttagatgaaaggatatttcttggagaggatgctgaggag
gaaattgggactctctccaggtgtctgaattctggttcaggaacagagacggctgaaagg
gtgcagatgaaaaacatcttgcagcagcacttcgacaagtctaaagcacttagaatctcc
acaccacttaccggggtgaggtacatgaaggataatagcccttgtgtgacccccgtgtct
acggcaacacacagcttgagccgtcttcacaccatgctaacaggccttaggaatgcaccg
agtgagaaactggaacagattctgaggacgtgttcccgagatccaacacaggccattgcc
aacagattgaaagaaatgtatgaaatatattctcagcattgccagtcagatgaggatttc
agtaattctaaagaaattgccagcaaacattttcgttttgcagagatgctttattataaa
gtattagaatctgttattgaacaggaacagaaaagactgggagacatggatttatctggc
attctggaacaagatgcattccatagatcgcttttggcctgctgccttgaggtcgtcact
ttttcttataagcctcctgggaattttccatttattactgaaatatttgatgtgccactt
tatcatttttataaggtgatagaagtattcattagagcggaagatggtctttgtagagag
gtggtaaaacaccttaaccagattgaagaacagatcttggatcatttggcatggaaacca
gagtctccactctgggacaggattcgagacaatgaaaacagagttcctacttgcgaagag
gttatgccacctcagaatctggaaagagcagatgatatttgtattgctggctctcctttg
actcccagaagggtgagtgaagttcgtgctgatactggaggacttggaagaagcataaca
tctccggccacattatatgatagatacagctcccccacagccagctctaccagaagacgg
ctatttgttgagaatgatagcccctctgatgcagggacacccgggcgccttcccccacaa
cccctagtcaatgctgtccctgtgcagaatgtatctggggatgctgtttctgtcacgcca
gttcctggacagactttggtcaccatggcaacagccactgtcacagccaacaatggacaa
acagtgaccattcctgtgcaaggtattgcgaatgaaaatggagggataacattcttccca
gtccaggtcaatgttggagggcagacacaagctgtgactggctccatccagcccctgagt
gctcaggccctggctggaagtttgagctctcaacaggtgacaggaacaaccttgcaagtc
cctggtcaggtggccattcaacagatttccccaggtggacaccagcagaaacaaggccca
cctttaaccagcagcagtattagacctaggaagaccagctctttatcacttttctttaga
aaggtttaccacttggcaggtgtccgtcttcgggatctttgtgctaaactggatatttca
gatgaactgaggaaaaaaatctggacctgttttgaattctccataattcagtgtcctgaa
cttatgatggacagacatctggaccagttgttgatgtgtgccatttatgtgatggcaaag
gtgacaaaagaagacaagtccttccagaatattatgcgttgttataggactcagccacag
gcccggagccaggtatatagaagtgttttgataaaagggaaaaggaaaagaagaaattct
ggcagcagtgatagcagaagccatcagaattctccaacagaactcaacaaagacagaacc
agcagagactccagtcctgtcatgaggtcaagcagcaccttgccggttccccagcccagc
agcgccccgcccacacccactcgcctcacgggtgccaacagtgacatggaagaggaggag
aggggcgacctcattcagttctacaacaatatttacataaagcaaattaaaacatttgcc
atgaagtactcacaggcaaacgtgacggatgctcctccactctccccctatccgtttgtg
aggacgggctctcctcgccgaatacagctgtctcagaatcaccctgtctacatttctcca
cacaaaaatgaaacaatgctttctcctcgagaaaagattttctactacttcagcaacagt
ccttcaaagagactgagagaaattaacagtatgatacggacaggagaaactccaaccaaa
aagagagggattcttttggaagatggaagcgaatcacccgcaaaaagaatttgcccagaa
aatcattctgccttactacgccgtctccaagatgtagctaatgaccgaggttctcactga

DBGET integrated database retrieval system