KEGG   Ailuropoda melanoleuca (giant panda): 100463878
Entry
100463878         CDS       T01329                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04390  Hippo signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100463878 (FGF1)
   04014 Ras signaling pathway
    100463878 (FGF1)
   04015 Rap1 signaling pathway
    100463878 (FGF1)
   04390 Hippo signaling pathway
    100463878 (FGF1)
   04020 Calcium signaling pathway
    100463878 (FGF1)
   04151 PI3K-Akt signaling pathway
    100463878 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100463878 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100463878 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100463878 (FGF1)
   05218 Melanoma
    100463878 (FGF1)
   05224 Breast cancer
    100463878 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100463878 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100463878 (FGF1)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100463878 (FGF1)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100463878 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100463878
NCBI-ProteinID: XP_019650803
Ensembl: ENSAMEG00000010197
UniProt: D2GUK9
LinkDB
Position
3
AA seq 155 aa
MAEGEITTFTALTEKFNLPAGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggagatcacaaccttcaccgccctgacggagaagtttaatctgcctgcg
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccagatggcacagtggacgggacgagggacaggagcgaccagcacattcaactgcag
ctcagcgcggaaagcgtaggggaggtgtacataaagagcaccgagaccggccagtacttg
gccatggacaccgatgggcttctgtacggctcacagacaccaaatgaggaatgtttgttc
ctggaaaggctggaggaaaaccattacaacacctacacatccaagaagcacgcggagaag
aattggtttgttggtctcaagaagaatggaagctgcaaacgtggtcctcggactcactat
ggccagaaagcaattctgtttctccccctgccagtctcctctgattaa

KEGG   Ailuropoda melanoleuca (giant panda): 100464088
Entry
100464088         CDS       T01329                                 

Gene name
FGF18
Definition
(RefSeq) fibroblast growth factor 18 isoform X2
  KO
K04358  fibroblast growth factor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100464088 (FGF18)
   04014 Ras signaling pathway
    100464088 (FGF18)
   04015 Rap1 signaling pathway
    100464088 (FGF18)
   04020 Calcium signaling pathway
    100464088 (FGF18)
   04151 PI3K-Akt signaling pathway
    100464088 (FGF18)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100464088 (FGF18)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100464088 (FGF18)
  09162 Cancer: specific types
   05226 Gastric cancer
    100464088 (FGF18)
   05218 Melanoma
    100464088 (FGF18)
   05224 Breast cancer
    100464088 (FGF18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100464088 (FGF18)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100464088 (FGF18)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100464088 (FGF18)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100464088 (FGF18)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100464088
NCBI-ProteinID: XP_011227761
Ensembl: ENSAMEG00000003903
UniProt: G1LB37
LinkDB
Position
3
AA seq 207 aa
MYSAPSACTCLCLHFLLLCFQVQVLAAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR
TSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKP
DGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPK
GQAELQKPFKYTTVTKRSRRIRPTHPG
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtattcagcgccctccgcctgcacttgcctgtgtttacacttcctgctgctgtgcttc
caggtacaggtgctggcggccgaggagaacgtggacttccgcatccacgtggagaaccag
acgcgggctcgggacgatgtgagccgtaagcagctgcggctgtaccagctctacagccgg
accagcgggaagcacatccaggtgctgggccgcaggatcagcgcccgcggcgaggacggg
gacaagtatgcccagctcctagtggagacagacaccttcggtagtcaagtccggatcaag
ggcaaggagacggaattctacctgtgtatgaaccggaaaggcaagctcgtggggaagcct
gatggcaccagcaaggagtgtgtattcattgagaaggtcctggagaacaactacacagcc
ctaatgtccgccaagtactctggctggtacgtgggcttcaccaagaaggggcggccacgg
aagggccccaagacgcgagagaaccagcaggacgtgcacttcatgaagcgttaccccaag
ggacaggcagagctgcagaagcccttcaagtacaccacggtgaccaagaggtcccggcgg
atccgccccacgcaccccggctag

KEGG   Ailuropoda melanoleuca (giant panda): 100466947
Entry
100466947         CDS       T01329                                 

Gene name
FGF16
Definition
(RefSeq) fibroblast growth factor 16
  KO
K04358  fibroblast growth factor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100466947 (FGF16)
   04014 Ras signaling pathway
    100466947 (FGF16)
   04015 Rap1 signaling pathway
    100466947 (FGF16)
   04020 Calcium signaling pathway
    100466947 (FGF16)
   04151 PI3K-Akt signaling pathway
    100466947 (FGF16)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100466947 (FGF16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100466947 (FGF16)
  09162 Cancer: specific types
   05226 Gastric cancer
    100466947 (FGF16)
   05218 Melanoma
    100466947 (FGF16)
   05224 Breast cancer
    100466947 (FGF16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100466947 (FGF16)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100466947 (FGF16)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100466947 (FGF16)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100466947 (FGF16)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100466947
NCBI-ProteinID: XP_002928806
Ensembl: ENSAMEG00000001956
LinkDB
Position
X
AA seq 207 aa
MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL
RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER
GELYGSKKLTRECVFREQFEENWYNTYASTLYKHLDSERQYYVALNKDGSPREGYRTKRH
QKFTHFLPRPVDPSKLPSMSRDLFRYR
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcggaggtggggggggtcttcgcctccttggactgggatctacacggcttctcctcg
tctctggggaacgtgcccttagctgactccccgggtttcctgaacgagcgcctaggccag
atcgaggggaagctgcagcgcggctcgcccacagacttcgcccacctgaaggggatcctg
cggcgccgccagctctactgccgcacgggcttccacctggagatcttccccaacggcacg
gtgcacggcacccgccacgaccacagccgtttcggaatcctggagttcatcagcctggct
gtggggttgatcagcatccggggagtggactctggcctgtacttaggaatgaatgagcga
ggagaactatatgggtcgaagaaactcacacgtgaatgtgttttccgggaacaatttgaa
gaaaactggtacaacacctatgcttccaccttgtacaaacacttggactcggagagacag
tattatgtggccttgaataaagacggctcaccccgggagggatacaggactaaacgacac
cagaaattcactcactttttgcccaggccagtagatccttctaagttgccctccatgtcc
agagacctcttccgttataggtaa

KEGG   Ailuropoda melanoleuca (giant panda): 100467527
Entry
100467527         CDS       T01329                                 

Gene name
FGF20
Definition
(RefSeq) fibroblast growth factor 20
  KO
K04358  fibroblast growth factor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100467527 (FGF20)
   04014 Ras signaling pathway
    100467527 (FGF20)
   04015 Rap1 signaling pathway
    100467527 (FGF20)
   04020 Calcium signaling pathway
    100467527 (FGF20)
   04151 PI3K-Akt signaling pathway
    100467527 (FGF20)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100467527 (FGF20)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100467527 (FGF20)
  09162 Cancer: specific types
   05226 Gastric cancer
    100467527 (FGF20)
   05218 Melanoma
    100467527 (FGF20)
   05224 Breast cancer
    100467527 (FGF20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100467527 (FGF20)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100467527 (FGF20)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100467527 (FGF20)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100467527 (FGF20)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100467527
NCBI-ProteinID: XP_034503588
Ensembl: ENSAMEG00000012058
LinkDB
Position
18
AA seq 211 aa
MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRGAVERGARGGPGAAELAHL
QGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDILMYS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctcccttagccgaagtcgggggcttcctcggcggcctggagggcttgggccagcag
gtgggctcgcacttcctgctgcctcctgccggggagcggccgcctctgctgggcgagcgc
aggggcgcggtggagcggggcgcccgcggcgggcctggggctgcggagctggcgcacttg
caaggcatcctgcgccgccggcagctctactgccgtacgggcttccacctgcagatcttg
ccggacggcagcgtgcagggcacccggcaggaccacagcctcttcggtatcctggaattc
atcagtgtggcagtgggactggtcagtattagaggtgtggacagtggtctttaccttgga
atgaatgacaaaggagaactctatggctcagagaaattgacttctgaatgcatctttagg
gagcaatttgaagagaactggtataatacctattcatccaacatatataaacatggggac
actggccgtaggtattttgtggcacttaacaaagacggaactccaagagatggtgccagg
tccaaaagacatcagaaattcacacatttcctgcctagaccagtggatccagagagagtt
cccgaattgtacaaggacatcctgatgtacagctga

KEGG   Ailuropoda melanoleuca (giant panda): 100468641
Entry
100468641         CDS       T01329                                 

Gene name
FGF5
Definition
(RefSeq) fibroblast growth factor 5 isoform X1
  KO
K04358  fibroblast growth factor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100468641 (FGF5)
   04014 Ras signaling pathway
    100468641 (FGF5)
   04015 Rap1 signaling pathway
    100468641 (FGF5)
   04020 Calcium signaling pathway
    100468641 (FGF5)
   04151 PI3K-Akt signaling pathway
    100468641 (FGF5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100468641 (FGF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100468641 (FGF5)
  09162 Cancer: specific types
   05226 Gastric cancer
    100468641 (FGF5)
   05218 Melanoma
    100468641 (FGF5)
   05224 Breast cancer
    100468641 (FGF5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100468641 (FGF5)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100468641 (FGF5)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100468641 (FGF5)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100468641 (FGF5)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100468641
NCBI-ProteinID: XP_002912526
Ensembl: ENSAMEG00000005239
UniProt: D2GUG1
LinkDB
Position
11
AA seq 269 aa
MSLSFLLLLFLSHLILSAWAHGEKHLAPKGQPGPAATGRNPGGASSSGSSSGTTSSSSSD
SSSPGASLGNQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANVLS
ILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIH
RTEPAGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQLEQPELSFTVTVPEKKKP
PSPVKPKLPVSAPRKSPNTVKYRLKFRFG
NT seq 810 nt   +upstreamnt  +downstreamnt
atgagcttgtccttcctcctcctcctcttcctcagccacctaatcctcagcgcctgggct
cacggggagaagcacctcgcccccaaagggcaacccggacccgctgccaccggtcggaac
ccgggaggcgccagcagcagcgggagcagcagtggcacgacgtcttcctcttcctccgac
tcctcctcccccggggcttctctgggcaaccaagggagcggcttggagcagagcagtttc
cagtggagcccctcggggcgccggaccggcagcctctactgcagagtgggcatcggtttc
catctgcagatctacccggatggcaaagtcaatggctcccatgaagccaatgtgttaagt
attttggaaatatttgctgtgtctcaggggattgtaggaatacgaggagttttcagcaac
aaatttttagcgatgtcaaaaaaaggaaaactccatgcaagtgccaaatttacagatgat
tgcaagttcagggagcgatttcaagaaaacagctataatacctatgcctcagcaatacac
agaactgagccagcgggccgggagtggtacgtggccctcaataagagagggaaggccaag
cggggctgcagcccccgggtcaaaccccagcacgtctccacccactttctgccaagattc
aagcagctagagcagccagaactttctttcacagttactgttcctgagaagaaaaagcca
cccagtccagtcaagccaaagcttcccgtgtccgcccctcggaagagtcccaacaccgtg
aaatacagactaaagtttcgctttggataa

KEGG   Ailuropoda melanoleuca (giant panda): 100470300
Entry
100470300         CDS       T01329                                 

Gene name
FGF19
Definition
(RefSeq) fibroblast growth factor 19
  KO
K22603  fibroblast growth factor 19
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100470300 (FGF19)
   04014 Ras signaling pathway
    100470300 (FGF19)
   04015 Rap1 signaling pathway
    100470300 (FGF19)
   04020 Calcium signaling pathway
    100470300 (FGF19)
   04151 PI3K-Akt signaling pathway
    100470300 (FGF19)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100470300 (FGF19)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100470300 (FGF19)
  09162 Cancer: specific types
   05226 Gastric cancer
    100470300 (FGF19)
   05218 Melanoma
    100470300 (FGF19)
   05224 Breast cancer
    100470300 (FGF19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100470300 (FGF19)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100470300 (FGF19)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100470300 (FGF19)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100470300 (FGF19)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100470300
NCBI-ProteinID: XP_011233903
Ensembl: ENSAMEG00000001986
LinkDB
Position
16
AA seq 262 aa
MRRYLERTAGSRDAPGLCTHSPAAAQPPAPSPPELRAEPKGVAMRSAPSRCAVARALVLA
GLCLAVAGRPLAFSDAGPHVHYGWGEPIRLRHLYTAGPHGLSSCFLRIRADGGVDCARGQ
SAHSLVEIRAVALRTVAIKGVHSVRYLCMGADGRMQGLPQYSAGDCAFEEEIRPDGYNVY
RSKKHRLPVSLSGAKQRQLYKDRGFLPLSHFLPMLPGSPAEPRDLQDHAESDGFSAPLET
DSMDPFGIATKMGLVKSPSFQK
NT seq 789 nt   +upstreamnt  +downstreamnt
atgcgcaggtacctagagcgcaccgccggctcgagggacgcgcccggcctctgcacgcac
agtcctgcagccgcccagcctcccgcaccctcgccgccagaactgcgtgcggagcccaag
ggagttgccatgcggagcgcgccgagccggtgcgcggtagcccgcgccctggtcctagcc
ggcctctgcctggcggtagccgggcgccccctagccttctcggacgcggggccgcacgtg
cactacggctggggtgagcccatccgcctacggcacctgtacaccgccggcccccacggc
ctctccagctgcttcctgcgcatccgtgccgacggcggggttgactgcgcgcggggccag
agcgcgcacagtttggtggagatcagggcagtcgctctgcggaccgtggccatcaagggt
gtgcacagcgtccggtacctctgcatgggcgcggacggcaggatgcaagggctgcctcag
tactctgcaggggactgtgctttcgaggaggagatccgccccgacggctacaatgtgtac
cggtccaagaagcaccgtctccccgtctctctgagcggtgccaaacagaggcagctttac
aaagacagaggctttctgcccctgtcccacttcttgcccatgctgcccgggagcccagca
gagcccagggacctccaggaccatgcggagtcggacgggttttctgcacccctagaaaca
gacagcatggacccttttgggatcgccaccaaaatgggactagtgaagagtcccagcttc
cagaaataa

KEGG   Ailuropoda melanoleuca (giant panda): 100470803
Entry
100470803         CDS       T01329                                 

Definition
(RefSeq) fibroblast growth factor 3
  KO
K04358  fibroblast growth factor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100470803
   04014 Ras signaling pathway
    100470803
   04015 Rap1 signaling pathway
    100470803
   04020 Calcium signaling pathway
    100470803
   04151 PI3K-Akt signaling pathway
    100470803
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100470803
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100470803
  09162 Cancer: specific types
   05226 Gastric cancer
    100470803
   05218 Melanoma
    100470803
   05224 Breast cancer
    100470803
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100470803
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100470803
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100470803
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100470803
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100470803
NCBI-ProteinID: XP_034500739
LinkDB
Position
16
AA seq 219 aa
MEEREPSALKRLGLAQSGRPKLGARQERSAERGSVARVRGSFAASRGARPRSEGPPVKKH
CSVQKEGILEMTAVEVGIVAIKGLFSGRYLAMNKRGRLYASESYNAECEFVERIHELGYN
TYASRLYRTVPSGPGAQRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHKD
HEMVRLLQSEAGLRSGLPGPPGKGTRPRRQRKQSRGGRV
NT seq 660 nt   +upstreamnt  +downstreamnt
atggaggagcgcgaacccagcgccctgaagcggctcggcttggcgcagagcgggaggccc
aagctcggggcgcggcaggagcgcagtgcggagcgtgggagcgtggccagggtccggggc
tccttcgcggcatcccggggcgctcgcccccgctccgagggacctccggtgaaaaagcac
tgcagtgtccagaaggaaggtatcctggagatgacagcggtggaggtgggcatcgtggcc
atcaaggggctcttctccgggcggtacctggccatgaacaagagggggcggctctatgct
tcggagagctacaacgccgagtgtgagttcgtggagcggatccacgagctgggctacaac
acgtacgcctcgcggctgtaccgcacagtgcccagcggcccgggggcccagcggcagccc
agcgccgagagactgtggtatgtgtccgtgaacgggaagggccggccccgcaggggcttc
aagacgcgccgcacccagaagtcctccttgttcctgccccgcgtgctggaccacaaggac
cacgagatggtgcggctgctccagagcgaggccgggctccgcagtggcctgcccgggccc
cccggcaagggcacccggccccggcggcagaggaagcagagccggggaggccgtgtgtag

KEGG   Ailuropoda melanoleuca (giant panda): 100471023
Entry
100471023         CDS       T01329                                 

Gene name
FGF6
Definition
(RefSeq) fibroblast growth factor 6
  KO
K04358  fibroblast growth factor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100471023 (FGF6)
   04014 Ras signaling pathway
    100471023 (FGF6)
   04015 Rap1 signaling pathway
    100471023 (FGF6)
   04020 Calcium signaling pathway
    100471023 (FGF6)
   04151 PI3K-Akt signaling pathway
    100471023 (FGF6)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100471023 (FGF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100471023 (FGF6)
  09162 Cancer: specific types
   05226 Gastric cancer
    100471023 (FGF6)
   05218 Melanoma
    100471023 (FGF6)
   05224 Breast cancer
    100471023 (FGF6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100471023 (FGF6)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100471023 (FGF6)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100471023 (FGF6)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100471023 (FGF6)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100471023
NCBI-ProteinID: XP_002920490
Ensembl: ENSAMEG00000015714
UniProt: D2HEJ8
LinkDB
Position
16
AA seq 208 aa
MALGQRLFITMSPGAGRLQGTLQALVFLGVLVGMVVPSPAGTRANSTLLDSRGWGTLLSR
SRAGLAAEIAGVNWESGYLVGIKRQRKLYCNVGIGFHLQVPPDGRISGTHEENPYSLLEI
STVERGVVSLFGVKSALFVAMNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYRGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI
NT seq 627 nt   +upstreamnt  +downstreamnt
atggccctgggacagaggctgttcatcactatgtccccgggagcaggacgtcttcagggc
acgctgcaggctctcgtcttcctaggcgtcctagtgggcatggtggtgccctcgcctgca
ggcacccgagccaacagcacgctgctggactccaggggctggggcaccctgctatcaagg
tctcgagctggactagctgcagagattgctggggtgaattgggagagtggctatttggtg
gggatcaagaggcagaggaagctctactgcaacgtgggcatcggctttcacctccaggtg
ccccccgacggccggatcagcgggacccacgaggagaacccctacagcctgctggagatt
tccacagtggagcggggtgtggtgagtctctttggagtgaaaagtgccctgttcgttgcc
atgaacagtaaagggagattatacgcaacgcccagcttccaagaggaatgcaagttcaga
gaaaccctcctgcccaacaattacaatgcctatgagtcagacctgtaccgagggacctac
atcgcactgagcaaatatggacgggtaaagcggggcagcaaggtgtccccaatcatgact
gtcactcacttccttcccaggatataa

KEGG   Ailuropoda melanoleuca (giant panda): 100472512
Entry
100472512         CDS       T01329                                 

Gene name
FGF23
Definition
(RefSeq) fibroblast growth factor 23
  KO
K22428  fibroblast growth factor 23
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04810  Regulation of actin cytoskeleton
aml04928  Parathyroid hormone synthesis, secretion and action
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100472512 (FGF23)
   04014 Ras signaling pathway
    100472512 (FGF23)
   04015 Rap1 signaling pathway
    100472512 (FGF23)
   04020 Calcium signaling pathway
    100472512 (FGF23)
   04151 PI3K-Akt signaling pathway
    100472512 (FGF23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100472512 (FGF23)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100472512 (FGF23)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100472512 (FGF23)
  09162 Cancer: specific types
   05226 Gastric cancer
    100472512 (FGF23)
   05218 Melanoma
    100472512 (FGF23)
   05224 Breast cancer
    100472512 (FGF23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100472512 (FGF23)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100472512 (FGF23)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100472512 (FGF23)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100472512 (FGF23)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100472512
NCBI-ProteinID: XP_002920496
Ensembl: ENSAMEG00000015720
UniProt: D2HEJ9
LinkDB
Position
16
AA seq 245 aa
MSGTRLGLLVSVLCWVGRAYPNTSPLLGSSWGGLTHLYTASARNSYHLQIHKDGHVDGTP
HQTIYSALMIRSEDAGFVVITGVMSRRYLCMDLRGNIFGSHLFSPESCRFRQRTLENGYD
VYHSPQHRFLVSLGQAKRTFLPGTNPPPYSQFLSRRNEIPLIHFNTPRPRRHTRSAEDTE
RDPLNVLKPRPRMTPAPASCSQELPSAEDNSVVASDPLGVLRGNRVNAHAGGMGVDRCRP
FPKFI
NT seq 738 nt   +upstreamnt  +downstreamnt
atgtcagggacccgccttgggctgctggtctctgtcctgtgctgggtaggcagagcctat
cccaacacctccccactgctcggctccagctggggtggcctgacccacctgtacacagcc
agcgccaggaacagctaccacctgcagatccacaaggacggccatgtggatggcacaccc
catcagaccatctacagtgccctgatgatcaggtcagaggatgccggctttgtggtgata
acaggtgtgatgagtaggcgatacctctgtatggacctcagaggcaacatctttggatcc
cacctcttcagcccggagagctgcaggttccgacagcggacgctggaaaacggctacgac
gtgtaccactcgccgcagcaccgcttcctcgtcagcctgggccaggccaagaggaccttc
ctgccggggaccaacccgccgccctactcccagttcctgtcccggaggaacgagatcccc
ctcatccacttcaacacccccaggccaaggcggcacacgcgcagcgccgaggacacggag
cgcgacccgttgaacgtgctgaagcccaggccccgcatgacccccgccccggcctcctgc
tcccaggagctcccgagcgccgaggacaacagtgtggtggccagcgacccgttaggggtg
ctcagaggcaaccgggtgaacgcgcacgccggggggatgggcgtggacaggtgccgcccc
ttccccaagttcatctag

KEGG   Ailuropoda melanoleuca (giant panda): 100473739
Entry
100473739         CDS       T01329                                 

Gene name
FGF9
Definition
(RefSeq) fibroblast growth factor 9
  KO
K04358  fibroblast growth factor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100473739 (FGF9)
   04014 Ras signaling pathway
    100473739 (FGF9)
   04015 Rap1 signaling pathway
    100473739 (FGF9)
   04020 Calcium signaling pathway
    100473739 (FGF9)
   04151 PI3K-Akt signaling pathway
    100473739 (FGF9)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100473739 (FGF9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100473739 (FGF9)
  09162 Cancer: specific types
   05226 Gastric cancer
    100473739 (FGF9)
   05218 Melanoma
    100473739 (FGF9)
   05224 Breast cancer
    100473739 (FGF9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100473739 (FGF9)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100473739 (FGF9)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100473739 (FGF9)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100473739 (FGF9)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100473739
NCBI-ProteinID: XP_002928971
Ensembl: ENSAMEG00000010945
UniProt: D2I195
LinkDB
Position
7
AA seq 208 aa
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcccttaggtgaagttgggaactatttcggtgtgcaggatgcggtaccatttggg
aatgtgcccgtgttgccggtggacagtccggttttgttaagtgaccacctgggtcagtcc
gaagcaggggggcttcccaggggacccgcagtcacggacttggatcatttaaaggggatt
ctcaggcggaggcagctatactgcaggactggatttcacttagaaatcttccccaatggt
actatccagggaaccaggaaagaccacagccgatttggcattctggaatttatcagtata
gcagtgggcctggtcagcattcgaggcgtggacagtggactctacctcgggatgaatgag
aagggggagctgtatggatcagaaaaactaacccaagagtgtgtattcagagaacagttt
gaagaaaactggtataacacgtactcctcgaatctatataaacacgtggacactggaagg
cgatactatgttgcattaaataaagacgggaccccaagagaaggaacgaggactaaacgg
caccagaaattcacacattttttacctagaccagtggaccccgacaaagtacctgaacta
tataaggatattctaagccaaagttga

KEGG   Ailuropoda melanoleuca (giant panda): 100474108
Entry
100474108         CDS       T01329                                 

Gene name
FGF17
Definition
(RefSeq) fibroblast growth factor 17 isoform X1
  KO
K04358  fibroblast growth factor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100474108 (FGF17)
   04014 Ras signaling pathway
    100474108 (FGF17)
   04015 Rap1 signaling pathway
    100474108 (FGF17)
   04020 Calcium signaling pathway
    100474108 (FGF17)
   04151 PI3K-Akt signaling pathway
    100474108 (FGF17)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100474108 (FGF17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100474108 (FGF17)
  09162 Cancer: specific types
   05226 Gastric cancer
    100474108 (FGF17)
   05218 Melanoma
    100474108 (FGF17)
   05224 Breast cancer
    100474108 (FGF17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100474108 (FGF17)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100474108 (FGF17)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100474108 (FGF17)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100474108 (FGF17)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 100474108
NCBI-ProteinID: XP_002914827
Ensembl: ENSAMEG00000003531
LinkDB
Position
5
AA seq 216 aa
MGATRLLPGLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSR
TSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKKGKLVGKP
SGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQ
GQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQPLT
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggagccacccgcctgctgcccggcctcactctgtgtctgcagctactgattctctgc
tgtcaaacccagggggagaatcacccgtctcctaattttaaccagtacgtgagggaccag
ggtgccatgaccgaccagctgagcaggcggcagatccgcgagtaccagctctacagccgg
accagcggcaagcacgtgcaggtcaccgggcgtcgcatctctgccaccgcggaggacggc
aacaagtttgccaaactcatagtggagacggacacctttggaagccgcgtgcgcatcaag
ggtgctgagagtgagaaatacatctgtatgaacaagaagggcaagctcgttggaaagccc
agcgggaagagcaaagactgcgtgttcacggagatcgtgctggagaacaactacacagcc
ttccagaacgcccggcacgagggatggttcatggccttcaccaggcagggtcggccccgt
caggcttctcgaagccgccagaaccaacgagaggctcacttcatcaagcgcctctaccag
ggccagttgcccttccccaaccacgcagagaggcagaagcagttcgagttcgtaggctca
gcccccacccgccggaccaagcgcactcggaggccacagcccctgacgtag

KEGG   Ailuropoda melanoleuca (giant panda): 100475745
Entry
100475745         CDS       T01329                                 

Gene name
FGF10
Definition
(RefSeq) fibroblast growth factor 10
  KO
K04358  fibroblast growth factor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100475745 (FGF10)
   04014 Ras signaling pathway
    100475745 (FGF10)
   04015 Rap1 signaling pathway
    100475745 (FGF10)
   04020 Calcium signaling pathway
    100475745 (FGF10)
   04151 PI3K-Akt signaling pathway
    100475745 (FGF10)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100475745 (FGF10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475745 (FGF10)
  09162 Cancer: specific types
   05226 Gastric cancer
    100475745 (FGF10)
   05218 Melanoma
    100475745 (FGF10)
   05224 Breast cancer
    100475745 (FGF10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100475745 (FGF10)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100475745 (FGF10)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100475745 (FGF10)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100475745 (FGF10)
SSDB
Motif
Pfam: FGF Fascin SR-25 IMUP
Other DBs
NCBI-GeneID: 100475745
NCBI-ProteinID: XP_002925532
Ensembl: ENSAMEG00000000586
UniProt: D2HSJ5
LinkDB
Position
3
AA seq 215 aa
MWKWILTHCASAFPHLPGCCCCFLLLFLVSSIPVTCQALGQDMVSPEATNSSSSSSSSSS
SSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEI
TSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNG
RQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
NT seq 648 nt   +upstreamnt  +downstreamnt
atgtggaaatggatactgacacattgtgcctcagcctttccccacctgcctggctgctgc
tgctgcttcttgttgctgttcttggtgtcttccatccctgtcacctgccaagcccttggt
caggacatggtgtcaccagaggccaccaactcctcttcttcctcctcctcctcctcgtcc
tcttcctccttctcctctccttccagtgcggggaggcatgtgcggagctacaatcacctc
caaggagatgtccgctggagaaagctattctcttttaccaagtactttctcaagattgag
aagaacgggaaggtcagcggtaccaagaaggagaactgcccgtacagtatcctagagata
acttcggtggaaatcggagttgttgccgtcaaagccattaacagcaactattatttagcc
atgaacaagaaggggaaactctatggctcaaaagaatttaacaatgactgtaagctgaag
gagaggatagaggaaaatggatataacacatatgcatcctttaactggcagcacaatggg
aggcaaatgtacgtggcattgaatggaaaaggagctcccaggagaggacagaaaacacga
aggaaaaacacctcagcgcattttcttccaatggtggtacactcgtag

KEGG   Ailuropoda melanoleuca (giant panda): 100478145
Entry
100478145         CDS       T01329                                 

Gene name
FGF21
Definition
(RefSeq) fibroblast growth factor 21
  KO
K22429  fibroblast growth factor 21
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04714  Thermogenesis
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100478145 (FGF21)
   04014 Ras signaling pathway
    100478145 (FGF21)
   04015 Rap1 signaling pathway
    100478145 (FGF21)
   04020 Calcium signaling pathway
    100478145 (FGF21)
   04151 PI3K-Akt signaling pathway
    100478145 (FGF21)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100478145 (FGF21)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100478145 (FGF21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100478145 (FGF21)
  09162 Cancer: specific types
   05226 Gastric cancer
    100478145 (FGF21)
   05218 Melanoma
    100478145 (FGF21)
   05224 Breast cancer
    100478145 (FGF21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100478145 (FGF21)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100478145 (FGF21)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100478145 (FGF21)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100478145 (FGF21)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100478145
NCBI-ProteinID: XP_034493835
LinkDB
Position
12
AA seq 209 aa
MGWDEARSEQLGLWVPVLAVLLLEACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQETEAH
LAIRADGTVVGAASRSPESLLELKALKPGVIQILGVKTSRFLCQGPDGTLYGSLRFDPVA
CSFRELLLEDGYNIYHSETLGLPLRLPAHNSPYRDSAPRGPARFLPLPGLLPVPPDPPGI
LGPEPPDVGSSDPLSMVGPSQGRSPSYAS
NT seq 630 nt   +upstreamnt  +downstreamnt
atgggctgggacgaggccaggtccgagcagctggggctgtgggtccctgtgctggctgtc
cttttgctggaagcttgccaggcacaccctatccctgactccagccccctcctccaattc
ggaggccaagttcgacagcggtacctctacacggacgatgcccaggagacagaggcccac
ctagcgatcagggctgatggcacagtggtgggggctgccagccggagcccagaaagtctc
ttggagctgaaagccctgaaaccgggggtcattcaaatcctgggagtgaaaacatctagg
ttcctgtgccagggcccagatgggacactgtacggatcgctccgcttcgaccccgtagcc
tgcagcttccgggaactgctcctggaggatgggtacaacatctaccactctgagaccctc
ggcctcccacttcgcctgcccgcccacaactctccataccgggactcggcgccccggggg
cctgcccgcttcctgcccctgccaggcctgcttccggtccccccggaccccccagggatc
ctgggccccgagcctcccgacgtgggctcctcggaccccctgagcatggtggggccttca
cagggccgaagtcccagctacgcttcctga

KEGG   Ailuropoda melanoleuca (giant panda): 100479573
Entry
100479573         CDS       T01329                                 

Gene name
FGF7
Definition
(RefSeq) fibroblast growth factor 7 isoform X1
  KO
K04358  fibroblast growth factor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100479573 (FGF7)
   04014 Ras signaling pathway
    100479573 (FGF7)
   04015 Rap1 signaling pathway
    100479573 (FGF7)
   04020 Calcium signaling pathway
    100479573 (FGF7)
   04151 PI3K-Akt signaling pathway
    100479573 (FGF7)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100479573 (FGF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100479573 (FGF7)
  09162 Cancer: specific types
   05226 Gastric cancer
    100479573 (FGF7)
   05218 Melanoma
    100479573 (FGF7)
   05224 Breast cancer
    100479573 (FGF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100479573 (FGF7)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100479573 (FGF7)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100479573 (FGF7)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100479573 (FGF7)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100479573
NCBI-ProteinID: XP_002917609
Ensembl: ENSAMEG00000001428
UniProt: D2H730
LinkDB
Position
5
AA seq 194 aa
MRKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGVPVRGKKTK
KEQKTAHFLPMAIT
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcgcaaatggatactgacatggatcctgccaactttgctctacagatcatgctttcac
attatctgtctagtgggcactatatctttagcttgcaatgacatgactccagagcaaatg
gctacaaatgtgaactgttccagccctgagcgacatacaagaagttatgattacatggaa
ggaggggatataagagtgagaagactcttctgtcgaacacagtggtatctgaggattgat
aaacgaggcaaagtcaaaggaacccaagagatgaagaacagttacaatatcatggaaatt
aggacagtggcagttggaattgtggcaatcaaaggagtggaaagtgaatactatcttgca
atgaataaagaaggaaaactctatgcaaagaaagaatgcaatgaagattgcaacttcaaa
gaattaattctggaaaaccattacaacacgtatgcatcagctaaatggacacacagcgga
ggagaaatgtttgttgctttaaaccaaaagggggttcctgtaagggggaaaaaaacgaag
aaagaacaaaaaacagcccactttcttcctatggcaataacataa

KEGG   Ailuropoda melanoleuca (giant panda): 100479986
Entry
100479986         CDS       T01329                                 

Gene name
FGF2
Definition
(RefSeq) LOW QUALITY PROTEIN: fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04810  Regulation of actin cytoskeleton
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100479986 (FGF2)
   04014 Ras signaling pathway
    100479986 (FGF2)
   04015 Rap1 signaling pathway
    100479986 (FGF2)
   04020 Calcium signaling pathway
    100479986 (FGF2)
   04151 PI3K-Akt signaling pathway
    100479986 (FGF2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100479986 (FGF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100479986 (FGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100479986 (FGF2)
   05205 Proteoglycans in cancer
    100479986 (FGF2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100479986 (FGF2)
   05218 Melanoma
    100479986 (FGF2)
   05224 Breast cancer
    100479986 (FGF2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100479986 (FGF2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100479986 (FGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100479986 (FGF2)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100479986 (FGF2)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100479986 (FGF2)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100479986 (FGF2)
SSDB
Motif
Pfam: FGF IL1 Fascin
Other DBs
NCBI-GeneID: 100479986
NCBI-ProteinID: XP_034517632
LinkDB
Position
5
AA seq 407 aa
MSRACVLRPKLPTRRPAPKSPERVGGGAQEGRRAGGVGEWWWVFGGGDVEDVTPRPGRCQ
TSGRGARGCCRIPGAAARAGGPPERPPRRHPALNPNSRAPRRTARXGSRRAERPRGSRLG
ARGRGRALPAAASPEQSFRERKLRCVSAVCIVFANSPRTKPSQRGPGLESVRAEATYAGF
NLPSWHLFSNFPICSLSSFSFPSFFWINLVLFLYSILPYSPAANCLGRSAVSLALELNPW
LVLEDLSSSCFAFGEGSLLVRGILLRDCPAPSLQRTAALHSAKISQPFCRVPAFDVCWLC
TGCKLCERELAVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLE
SNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgtcgcgcgcttgcgtgctgcggccaaagctcccgacccggaggccggccccaaaaagc
cccgagcgagtagggggcggcgcgcaggaagggaggagggccgggggcgtgggggagtgg
tggtgggtgttcgggggtggagatgtagaagatgtgacgccgcggccgggccggtgccag
accagcggacgcggtgcccgcggttgctgccggatcccgggcgctgcagctagggcaggc
ggccctcctgagcggccgccgcggagacacccagccctaaaccccaactcccgagccccg
cggcgcaccgcgcgctagggcagccggagagcggagaggccgagaggctcgaggctgggg
gcccgcgggcgcggtcgcgcgctgccggcggctgcatctcccgagcaaagtttccgagag
cgtaagctccggtgcgtaagcgctgtgtgcatcgtgtttgctaatagcccacggaccaaa
cccagtcagcgtggcccaggattggagtcagtacgggcagaggctacatatgctgggttt
aatctgccatcttggcacttgttttctaatttccccatctgttctttgtccagtttctct
tttccttccttcttttggattaatttggtactttttttgtattctattttgccttatagc
ccagctgccaactgtttgggtaggtcagcagttagccttgctcttgaactcaacccctgg
cttgtcttggaagatctctcttcatcctgctttgcatttggtgaaggctcattgcttgtc
agagggatcttactcagagattgtcctgctcctagccttcagcgaactgctgctttgcac
tcagcaaaaatttctcagcccttctgtcgtgtcccagcctttgatgtgtgttggttgtgc
actgggtgcaagctgtgtgaaagagaactggcagtcaaactgcaacttcaagcggaagag
agaggggttgtatccatcaaaggagtatgtgcaaatcgctatcttgccatgaaggaagat
ggaagattactggcttctaaatgtgttaccgatgagtgtttcttttttgagcgactggaa
tctaataactacaatacttaccggtcaaggaaatactccagttggtatgtggcactgaaa
cgaactgggcagtataaacttggacccaaaacaggacctgggcagaaagctatacttttt
cttccaatgtctgctaagagctga

KEGG   Ailuropoda melanoleuca (giant panda): 100481939
Entry
100481939         CDS       T01329                                 

Gene name
FGF22
Definition
(RefSeq) fibroblast growth factor 22 isoform X2
  KO
K04358  fibroblast growth factor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100481939 (FGF22)
   04014 Ras signaling pathway
    100481939 (FGF22)
   04015 Rap1 signaling pathway
    100481939 (FGF22)
   04020 Calcium signaling pathway
    100481939 (FGF22)
   04151 PI3K-Akt signaling pathway
    100481939 (FGF22)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100481939 (FGF22)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100481939 (FGF22)
  09162 Cancer: specific types
   05226 Gastric cancer
    100481939 (FGF22)
   05218 Melanoma
    100481939 (FGF22)
   05224 Breast cancer
    100481939 (FGF22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100481939 (FGF22)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100481939 (FGF22)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100481939 (FGF22)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100481939 (FGF22)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100481939
NCBI-ProteinID: XP_002923574
Ensembl: ENSAMEG00000002789
LinkDB
Position
4
AA seq 170 aa
MRGRLWLGLAWLLLARPPGAAGTPGSPRRPRSYPHLEGDVRWRRLFSSTHFFLRVDPSGR
VQGTRWRHGADSIIEIRSIRVGVVALKAVHTGFYVAMNRRGHLYGSRVYTAHCRFQERIE
ENGYNTYASLRWRHRGRPMFLALDGQGAPRRGGRTQRHHLSTHFLPVLVS
NT seq 513 nt   +upstreamnt  +downstreamnt
atgcgcggccgcctgtggctgggcctggcgtggctgctgctggcacggccgcccggcgcc
gcggggaccccgggcagtccgcggagaccgcgcagctacccacacctagagggcgacgtg
cgctggcggcgcctcttctcctccacccacttcttcctgcgcgtggaccccagcggccgc
gtgcagggcacccgctggcgccacggcgccgacagcatcattgagatccgctccatccgc
gtgggcgttgtggccctcaaggctgtgcacaccggcttctatgtggccatgaaccgcagg
ggccacctctacgggtcgcgggtctacactgcccactgcaggttccaggagcgcatcgag
gagaacggctacaacacctacgcctcgctccgctggcgtcaccgtggtcggcccatgttc
ctggcgctggatgggcagggggccccgcggcgtggtggccggacacagcggcaccacctg
tccacccacttcctgcctgtcctggtctcctga

KEGG   Ailuropoda melanoleuca (giant panda): 100482817
Entry
100482817         CDS       T01329                                 

Gene name
FGF8
Definition
(RefSeq) fibroblast growth factor 8
  KO
K04358  fibroblast growth factor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100482817 (FGF8)
   04014 Ras signaling pathway
    100482817 (FGF8)
   04015 Rap1 signaling pathway
    100482817 (FGF8)
   04020 Calcium signaling pathway
    100482817 (FGF8)
   04151 PI3K-Akt signaling pathway
    100482817 (FGF8)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100482817 (FGF8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100482817 (FGF8)
  09162 Cancer: specific types
   05226 Gastric cancer
    100482817 (FGF8)
   05218 Melanoma
    100482817 (FGF8)
   05224 Breast cancer
    100482817 (FGF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100482817 (FGF8)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100482817 (FGF8)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100482817 (FGF8)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100482817 (FGF8)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100482817
NCBI-ProteinID: XP_034519510
LinkDB
Position
6
AA seq 231 aa
SALSCLLLHLLVLCLQAQEGVGGRRGAAALGRELASLTRAGRESQGVSQQHVREQSLVTD
QLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAET
GLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSK
TRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
NT seq 696 nt   +upstreamnt  +downstreamnt
tcggcgctgagctgcctgctgttgcacttgctggttctctgcctccaagcccaggaaggc
gtgggggggcggaggggggcggcggcgctgggcagggaacttgcttccctgacccgagct
ggccgggagtcccagggtgtttcccaacagcatgtgagggagcagagcctggtgacggat
cagctcagccgccgccttatccggacctaccagctctacagccgcaccagcgggaagcac
gtgcaggtcctggccaacaagcgcatcaacgccatggcagaagacggggaccccttcgca
aagctcattgtggagacagatacctttgggagccgggttcgagtccgcggagctgagact
ggcctctacatctgcatgaataagaaggggaagctgatcgccaagagcaacggcaagggc
aaggactgcgtgttcacggagatcgtgctggagaacaactacacggccctgcagaacgcc
aagtacgagggctggtacatggccttcacccgcaagggccggccgcgcaagggctccaag
acgcggcagcaccagcgcgaggtgcacttcatgaagcggctgccgcgcggccaccacacc
accgagcagagcctgcgcttcgagttcctcaactacccgccgttcacgcgcagcctgcgc
ggcagccagaggacttgggcccccgagccccggtag

DBGET integrated database retrieval system