KEGG   Ailuropoda melanoleuca (giant panda): 100464004
Entry
100464004         CDS       T01329                                 

Gene name
YWHAG
Definition
(RefSeq) 14-3-3 protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04114  Oocyte meiosis
aml04151  PI3K-Akt signaling pathway
aml04390  Hippo signaling pathway
aml05160  Hepatitis C
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100464004 (YWHAG)
   04151 PI3K-Akt signaling pathway
    100464004 (YWHAG)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100464004 (YWHAG)
   04114 Oocyte meiosis
    100464004 (YWHAG)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100464004 (YWHAG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100464004 (YWHAG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100464004 (YWHAG)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aml03400]
    100464004 (YWHAG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100464004 (YWHAG)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100464004 (YWHAG)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100464004 (YWHAG)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100464004 (YWHAG)
SSDB
Motif
Pfam: 14-3-3 DUF722 DUF3504 Peptidase_C98 Orbi_VP5 SF3A2 FlaC_arch
Other DBs
NCBI-GeneID: 100464004
NCBI-ProteinID: XP_002923510
Ensembl: ENSAMEG00000010838
UniProt: D2HM80
LinkDB
Position
10
AA seq 247 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggccgagcaggcggagcgctac
gacgacatggccgcggccatgaagaacgtgacagagctgaatgagccactgtccaatgaa
gagagaaacctcctgtctgtggcctacaagaatgtggttggggcacgccgttcctcctgg
agggtcattagtagcattgagcagaagacatctgcagatggcaatgagaagaagattgag
atggtccgtgcttaccgtgaaaaaatcgagaaggagctggaagcggtatgtcaggatgtg
ctgagcctgctggataactacctgatcaagaattgcagtgagacccagtacgagagcaaa
gtgttttacctgaagatgaaaggggactattatcgctacctggctgaagtcgccactgga
gagaagcgggcgactgtcgtggagtcctctgagaaggcctatagcgaagcccatgagatc
agcaaggagcatatgcagcctactcaccccattagattaggcctggctcttaactactcc
gttttctactacgagatccagaatgccccggagcaagcctgccacttggccaagaccgcc
ttcgatgacgccatcgccgagctcgacactctgaatgaggactcctacaaggactccact
ctcatcatgcagctcctccgcgacaacctaacgctctggacaagcgatcagcaagacgac
gacggtggcgaaggcaacaattaa

KEGG   Ailuropoda melanoleuca (giant panda): 100466234
Entry
100466234         CDS       T01329                                 

Gene name
YWHAB
Definition
(RefSeq) 14-3-3 protein beta/alpha
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04114  Oocyte meiosis
aml04151  PI3K-Akt signaling pathway
aml04390  Hippo signaling pathway
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100466234 (YWHAB)
   04151 PI3K-Akt signaling pathway
    100466234 (YWHAB)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100466234 (YWHAB)
   04114 Oocyte meiosis
    100466234 (YWHAB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100466234 (YWHAB)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100466234 (YWHAB)
   05160 Hepatitis C
    100466234 (YWHAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aml03400]
    100466234 (YWHAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100466234 (YWHAB)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100466234 (YWHAB)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100466234 (YWHAB)
SSDB
Motif
Pfam: 14-3-3 FliM SF3A2 Peptidase_C98
Other DBs
NCBI-GeneID: 100466234
NCBI-ProteinID: XP_034497825
Ensembl: ENSAMEG00000004088
LinkDB
Position
13
AA seq 244 aa
MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWR
VISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLK
MKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAG
EGEN
NT seq 735 nt   +upstreamnt  +downstreamnt
atggataaaagtgagctggttcagaaagccaaacttgccgagcaggccgagcgctacgac
gacatggccgcggccatgaaggccgtcacggagcaggggcacgagctctccaacgaggag
aggaatctgctctcggtcgcctacaagaacgtggtgggcgcccgccgctcctcctggcgc
gtcatctccagcatcgagcagaaaacagagaggaatgagaagaagcagcagatgggcaaa
gagtaccgggagaagatcgaggccgagctgcaggacatctgcaatgatgttctggagctg
ttggacaaataccttattcccaatgctacacaaccagaaagcaaggtgttctacttgaaa
atgaaaggagattattttagatatctttctgaggtggcatctggagataataagcaaacc
actgtgtcgaactcccagcaggcttaccaggaagcatttgaaattagtaagaaagaaatg
cagcctacacacccaattcgacttggcctggcactgaacttctcagtcttctactatgag
attctaaactctcctgaaaaggcttgtagcctggcaaaaacggcattcgatgaggccatt
gctgaattggatacactgaatgaagagtcttacaaagacagcaccctgatcatgcagttg
cttagggacaatctcactctgtggacgtcggaaaaccagggagatgaaggagatgctggg
gagggagagaactaa

KEGG   Ailuropoda melanoleuca (giant panda): 100467650
Entry
100467650         CDS       T01329                                 

Gene name
YWHAH
Definition
(RefSeq) 14-3-3 protein eta isoform X1
  KO
K16198  14-3-3 protein gamma/eta
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04114  Oocyte meiosis
aml04151  PI3K-Akt signaling pathway
aml04390  Hippo signaling pathway
aml05160  Hepatitis C
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100467650 (YWHAH)
   04151 PI3K-Akt signaling pathway
    100467650 (YWHAH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100467650 (YWHAH)
   04114 Oocyte meiosis
    100467650 (YWHAH)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100467650 (YWHAH)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100467650 (YWHAH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100467650 (YWHAH)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aml03400]
    100467650 (YWHAH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100467650 (YWHAH)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100467650 (YWHAH)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100467650 (YWHAH)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100467650 (YWHAH)
SSDB
Motif
Pfam: 14-3-3
Other DBs
NCBI-GeneID: 100467650
NCBI-ProteinID: XP_011218540
LinkDB
Position
12
AA seq 275 aa
MNITSLCQGHTVVELQLTATNLLCSTSVHPPETWEDPPGPHLRPKDPAALGVTWRMVSVT
ELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEK
ELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASE
AAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTL
NEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
NT seq 828 nt   +upstreamnt  +downstreamnt
atgaacattacttctctgtgtcaaggtcacacggtggtagagctacaactgacggccacc
aacctgctatgttcaaccagtgtacatcctccggagacctgggaggatccgcctggaccc
caccttagacctaaagatcctgcagctctaggcgtcacctggaggatggtgtcggtgaca
gagctcaatgaacctctttctaatgaagatcgaaacctcctctcggtggcctacaagaac
gtggttggtgccaggcgatcttcctggagggtcatcagcagcattgagcagaaaaccatg
gctgatggaaatgaaaaaaaattggagaaagttaaagcttaccgggagaagattgagaag
gagctggaaacagtgtgcaatgatgtcctggcgctgctcgacaagttcctcatcaagaac
tgcaatgatttccagtatgagagcaaggtattttacctgaaaatgaaaggcgattactac
cgctacttggcagaggtagcttccggggagaagaaaaacagtgtggtcgaagcttccgag
gccgcctacaaggaagcctttgaaatcagcaaagagcacatgcagccgacgcaccccatc
cggctgggtctggccctcaacttctccgtgttctactatgagatccagaatgcacctgag
caggcctgcctcttagccaaacaagccttcgatgatgccatagctgagctggacacacta
aacgaggattcctataaggactccacgctcatcatgcagttgctgcgagacaacctcacc
ctctggacgagcgaccagcaggatgaagaagcaggagaaggcaactga

KEGG   Ailuropoda melanoleuca (giant panda): 100483021
Entry
100483021         CDS       T01329                                 

Gene name
YWHAQ
Definition
(RefSeq) 14-3-3 protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04114  Oocyte meiosis
aml04151  PI3K-Akt signaling pathway
aml04390  Hippo signaling pathway
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100483021 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    100483021 (YWHAQ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100483021 (YWHAQ)
   04114 Oocyte meiosis
    100483021 (YWHAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100483021 (YWHAQ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100483021 (YWHAQ)
   05160 Hepatitis C
    100483021 (YWHAQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aml03400]
    100483021 (YWHAQ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100483021 (YWHAQ)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100483021 (YWHAQ)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100483021 (YWHAQ)
SSDB
Motif
Pfam: 14-3-3 FliM
Other DBs
NCBI-GeneID: 100483021
NCBI-ProteinID: XP_034515816
Ensembl: ENSAMEG00000008618
LinkDB
Position
4
AA seq 245 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaagacggagctaatccagaaggcgaagctggccgaacaggccgagcgttacgac
gacatggccacctgcatgaaggccgtgaccgagcagggcgccgagctgtctaacgaggag
cgcaacctgctctcggtggcctacaagaacgtggtcgggggccgcaggtccgcctggagg
gtcatctcgagcatcgagcagaaaaccgacacctcggacaagaagttgcagctgattaag
gactatcgggagaaagtggagtctgagctgaggtccatctgcaccacggtgctggaattg
ttggataaatatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggagattacttccggtaccttgctgaagttgcatgtggcgatgatcgaaaacaa
acaatagataattcccaaggagcttaccaagaggcttttgatatcagcaagaaagagatg
caacccacacacccaatccgcctggggctggctcttaacttttctgtattttactatgag
atccttaataacccagagcttgcctgcacactggctaaaacagcttttgacgaggccatt
gcagaacttgatacactgaatgaagattcatacaaagacagcaccctcatcatgcagttg
cttagagacaacctaacattatggacatcagacagtgcaggagaagaatgtgatgcggca
gaaggggcagaaaactaa

KEGG   Ailuropoda melanoleuca (giant panda): 100484483
Entry
100484483         CDS       T01329                                 

Gene name
YWHAZ
Definition
(RefSeq) 14-3-3 protein zeta/delta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04114  Oocyte meiosis
aml04151  PI3K-Akt signaling pathway
aml04390  Hippo signaling pathway
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100484483 (YWHAZ)
   04151 PI3K-Akt signaling pathway
    100484483 (YWHAZ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100484483 (YWHAZ)
   04114 Oocyte meiosis
    100484483 (YWHAZ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100484483 (YWHAZ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100484483 (YWHAZ)
   05160 Hepatitis C
    100484483 (YWHAZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aml03400]
    100484483 (YWHAZ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100484483 (YWHAZ)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100484483 (YWHAZ)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100484483 (YWHAZ)
SSDB
Motif
Pfam: 14-3-3 CSN7a_helixI FliM Peptidase_C98
Other DBs
NCBI-GeneID: 100484483
NCBI-ProteinID: XP_011235380
Ensembl: ENSAMEG00000000328
UniProt: G1L0F5
LinkDB
Position
9
AA seq 245 aa
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggataaaaatgagctggtgcagaaggccaaactggccgagcaggctgagcgatatgat
gacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagg
gtcgtctcaagtattgagcaaaagacggaaggtgctgagaaaaaacagcagatggctcga
gaatacagagagaaaattgagaccgagctaagagatatctgcaatgatgtactgtctctt
ttggaaaagtttttgatccccaatgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagactactaccgttacttggccgaggttgctgctggtgatgacaagaaaggg
attgtggatcagtcacaacaagcataccaagaagcttttgagatcagcaaaaaggaaatg
caaccaacacatcctatcagactgggtctggcccttaacttctctgtgttctattacgaa
attctgaactccccggagaaagcttgctctcttgcaaagacagcttttgatgaagccatt
gctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcaatta
ctgagagacaacttgacattgtggacatcggacacccagggagacgaagctgaagcagga
gaaggaggggaaaattaa

KEGG   Ailuropoda melanoleuca (giant panda): 100484851
Entry
100484851         CDS       T01329                                 

Gene name
YWHAE
Definition
(RefSeq) 14-3-3 protein epsilon isoform X2
  KO
K06630  14-3-3 protein epsilon
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04114  Oocyte meiosis
aml04151  PI3K-Akt signaling pathway
aml04390  Hippo signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04722  Neurotrophin signaling pathway
aml05160  Hepatitis C
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100484851 (YWHAE)
   04151 PI3K-Akt signaling pathway
    100484851 (YWHAE)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100484851 (YWHAE)
   04114 Oocyte meiosis
    100484851 (YWHAE)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100484851 (YWHAE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100484851 (YWHAE)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100484851 (YWHAE)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100484851 (YWHAE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aml03400]
    100484851 (YWHAE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100484851 (YWHAE)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100484851 (YWHAE)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100484851 (YWHAE)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 100484851
NCBI-ProteinID: XP_002918088
Ensembl: ENSAMEG00000008214
UniProt: G1LNL1
LinkDB
Position
13
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggccgagcaggctgagcgatac
gacgaaatggtggaatcaatgaagaaagtggcagggatggatgtggagttgacagttgaa
gaaagaaacctcctatctgttgcatataaaaatgtgatcggagccagaagagcttcctgg
agaataatcagcagcattgaacagaaagaagaaaacaagggaggagaagacaaactaaaa
atgattcgggaatatcggcaaatggttgagactgagctaaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggctgaatttgccacaggaaatgac
aggaaggaggctgcggagaacagcctagtggcttataaagctgctagtgatattgcaatg
acagaacttccacccacgcatccaattcgcttaggtcttgctctcaacttttccgtattc
tactatgaaattcttaattcccccgaccgtgcctgcaggttggcaaaagcagcttttgat
gatgcaattgcagaactggatacgctgagtgaagaaagctataaggactctacgcttatc
atgcagttgttacgtgataatctgacactatggacttcagacatgcagggtgatggtgaa
gagcagaataaagaagcgctgcaggatgtggaagatgaaaatcagtga

DBGET integrated database retrieval system