KEGG   Ailuropoda melanoleuca (giant panda): 100464163
Entry
100464163         CDS       T01329                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1 isoform X1
  KO
K02084  apoptotic protease-activating factor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01524  Platinum drug resistance
aml04115  p53 signaling pathway
aml04210  Apoptosis
aml04215  Apoptosis - multiple species
aml05010  Alzheimer disease
aml05012  Parkinson disease
aml05014  Amyotrophic lateral sclerosis
aml05016  Huntington disease
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05134  Legionellosis
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05164  Influenza A
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100464163 (APAF1)
   04215 Apoptosis - multiple species
    100464163 (APAF1)
   04115 p53 signaling pathway
    100464163 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100464163 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100464163 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100464163 (APAF1)
   05012 Parkinson disease
    100464163 (APAF1)
   05014 Amyotrophic lateral sclerosis
    100464163 (APAF1)
   05016 Huntington disease
    100464163 (APAF1)
   05020 Prion disease
    100464163 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    100464163 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100464163 (APAF1)
   05152 Tuberculosis
    100464163 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100464163 (APAF1)
   05160 Hepatitis C
    100464163 (APAF1)
   05164 Influenza A
    100464163 (APAF1)
   05162 Measles
    100464163 (APAF1)
   05168 Herpes simplex virus 1 infection
    100464163 (APAF1)
   05169 Epstein-Barr virus infection
    100464163 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100464163 (APAF1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD Ge1_WD40 eIF2A WD40_like CARD_2 Utp8 AAA_16 Hira TFIIIC_delta AAA_18 AAA_22
Other DBs
NCBI-GeneID: 100464163
NCBI-ProteinID: XP_002920324
Ensembl: ENSAMEG00000010759
LinkDB
Position
15
AA seq 1250 aa
MDAKARNCLLQHREALERDIKTSYIMDRMINDGVLTVSEEEKVKNEPTQQQRAALLIKMI
LKKDNYSYISFYNALIHEGYKDLAALLHSGIPVISSSNGGKDSVGGITSYVKTVLCEGGV
PQRPVVFVTRKELVNAIRQNLFKLNGEPGWVVIYGMAGCGKSVLAAEAVRDHFFLDGCFP
GGVHWVSIGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLHKHPRSL
LILDDIWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVSVESGLGKEKGLEILSLFV
SMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWDYYLRQLQNKQFKRIRKSSSY
DYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFV
NKSLLFCDRNGKSFCYYLHDLQVDFLIEKNRNQLQDLHKKIITQFQKHYQPHTLSPDQED
CMYWYNFLAYHMASANMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCA
VCENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDHGVLYLEWIN
KKNIKNLSRLVVRPHTDAVYHACFSEDGQRIASCGVDKTLQVFKAETGEKLLEIKAHEDE
VLCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHIYDEHSEQVNCCHFTNNSHYLLLATA
SSDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDVKSANERK
SINVKQFFLNSEEPQEDMEVIVKCCSWSPDGARIMVAAKNKIFLFDIHTSGLLAEIHTVH
HSTIQYCDFSLQNHLAVVALSQCCVELWNMDSCLKVADCRGHLSWVHCVMFSPDGSSFLT
SSDDQTIRLWETKKVCKNSAIVLKQEIDVVFQENEVMVLAVDNIKRLQLINGKTGQIDYL
TEAQVSCCCLSPHLQYIAFGGEDGAIEILELLNNRIFQSRIGHKKTVQHIQFTDDGKTLI
SSSDDSSIQVWNWQSEEYVFLQAHQETVKDFKLLKNSKLLSWSFDGTVKVWSIITGRIEK
DFVCHQDTVLSCDISPDATKFSSTSADKTAKIWSFDLLSPLHELRGHKGCVRCSVFSVDS
TLLATGDDNGEIRIWNVSNGELLHLCAPISVEEGAATHGGWVTDLCFSPDSKMLVSAGGY
LKWWNVVTGESSQTFYTNGTCLKKIYVSPDFKTYVTVDNLGILYILQMLE
NT seq 3753 nt   +upstreamnt  +downstreamnt
atggacgcaaaagctcgaaactgtttgcttcaacatagagaagccctggaaagagacatc
aaaacgtcctacatcatggatcgtatgattaatgatggagttttaacagtgtcggaggag
gaaaaagtaaaaaatgagcccactcaacagcagcgagcagctctgttaattaaaatgata
cttaaaaaagataattattcctacatatcgttctacaatgctctcatacatgaagggtat
aaagatcttgctgcccttctccatagtggcattcctgtcatctcttcttccaatggtgga
aaagattcagttggtggaataacttcatatgtaaagacagtcctgtgtgaaggtggcgtg
ccacagaggccagttgtttttgttaccaggaaggagctggtgaatgcaattcggcagaac
ctattcaaactaaatggtgaaccaggatgggttgtcatatatggaatggcaggttgcggg
aagtctgttttagctgcagaagctgttcgagatcattttttcttagatggttgtttccca
gggggtgtgcactgggtttcaattgggaaacaagacaaatctggacttctgatgaagttg
cagaatctttgcacacggttggatcaggatgagagtttctctcagaggcttccactcaat
atcgaagaggctaaagaccgtcttcgcattctgatgctgcacaaacacccaaggtctctg
ttgatcttggatgatatttgggatccttgggtattaaaagcttttgacaatcagtgtcaa
attcttcttacaaccagagacaagagcgttacagattcagtaatgggtcctaaatatgta
gtctctgtggagagtggcttaggaaaagaaaaaggacttgaaattttatccctttttgtt
agtatgaagaaagcagatttgccagagcaagctcacagtattataaaagaatgtaaaggt
tctcctcttgtagtgtctttaattggtgcacttttacgtgattttcccaaccgttgggat
tactacctcaggcaacttcagaataagcagtttaagagaataaggaaatcttcttcttat
gattatgaggctctggatgaagccatgtctataagtgttgaaatgctcagagaggacatc
aaagattattacacagatctttccatccttcagaaggatgttaaggtgcctacaaaggtg
ttatgtattctctgggacatggaaactgaagaagttgaagacatactgcaggagtttgtt
aataagtctctcttattctgtgatcggaatggaaaatcattttgttattatttacatgat
cttcaggtagatttccttatagagaagaatcgcaaccagcttcaggatctgcataagaag
ataatcactcagttccagaaacattaccagccacatactctttcaccagatcaggaggac
tgcatgtattggtataattttctggcctaccacatggctagtgccaatatgcacaaagaa
ctttgtgctttaatgttttccctggattggattaaagcaaaaactgaacttgtaggccct
gctcatctgattcatgaatttgtggaatacaggcatatattggatgaaaaggattgtgca
gtctgtgaaaatttccaggaatttttatctttaaatggacatcttcttggacgacagcca
tttcctaatattgtacaactgggtctctgtgaaccagaaacttcagaagtttatcagcaa
gctaagctgcaggccaagcaggaggtcgatcatggagtgctttacctggagtggataaac
aaaaaaaacatcaagaatctttcccgcttagttgtccgcccccatacagatgctgtttac
catgcttgcttttctgaggatggtcaaagaatagcttcttgtggagttgataagacctta
caggtgttcaaagctgaaacaggagagaaactgctagaaatcaaggctcatgaggatgaa
gtgctttgttgtgcattctctacagatgacagatttatagcaacctgctcagtggataaa
aaagtgaagatctggaattctatgacaggggaactagtgcatatctatgatgagcactca
gagcaagtcaactgctgccactttaccaacaacagtcattaccttctcttagccactgcg
tcaagtgactgcttcctcaaactctgggatttgaatcaaaaagaatgtcgaaataccatg
tttggccacacaaattcagtcaatcattgcagattttcaccagatgataagcttttggct
agttgttcagctgatggaacattaaagctttgggatgtgaaatcagcaaatgagaggaaa
agcattaatgtgaagcagttcttcctaaattcagaggagcctcaagaggatatggaagtg
atagtgaaatgttgttcatggtctcctgatggtgctaggataatggtggcagcaaaaaat
aaaatcttcctttttgacattcataccagtggcttactggcagaaatccatacagtccat
cacagcaccatccagtattgtgacttctctctgcaaaaccatttggcagtggtggctttg
tcccagtgctgtgtggagttgtggaatatggactcgtgtttaaaagtggctgattgcaga
ggacatttaagttgggttcattgtgtgatgttttctcctgatggatcatcatttttgaca
tcttctgatgaccagacaatcaggctctgggagacaaaaaaagtatgtaagaactctgct
atagtgttaaagcaagaaatagatgttgtgtttcaagaaaatgaagtgatggttcttgca
gttgacaatataaaacgcctgcagctcattaatggaaaaacaggtcagattgattatctg
actgaagctcaagttagttgctgttgcctaagtccacatcttcagtacattgcatttggg
ggtgaagatggagccattgagattttagaactcctaaacaacagaatcttccaatccagg
attgggcacaagaaaactgttcagcacatccagttcacagatgatgggaagactcttatt
tcaagctctgatgattcttcaattcaggtatggaattggcaatcagaagaatacgtcttt
ctacaagcccatcaggaaacagtaaaagactttaagctcttgaaaaattcaaaactgctt
tcttggtcatttgatggaacagtgaaggtatggagtattattactggaagaatagaaaaa
gactttgtctgtcaccaggatacagtactttcttgtgatatttctcctgatgctaccaag
ttttcatctacatctgctgacaagactgcaaagatttggagttttgaccttctttcccct
cttcatgaattgaggggccacaaaggctgtgtacgctgctctgtcttctctgtggacagt
actctgttggcgactggagatgacaatggagaaatcaggatatggaatgtctcaaatggt
gaactgcttcatttgtgtgctccgatttccgtagaagaaggagctgctacgcatggaggt
tgggtgactgacctttgcttttctccagatagcaaaatgcttgtctctgctggaggatat
cttaagtggtggaatgttgtcactggggagtcctcacagaccttctacacaaatggaacc
tgccttaagaaaatatacgtgtcccctgacttcaaaacatatgtgactgttgataatctt
ggtattttatatattttacagatgttagagtaa

DBGET integrated database retrieval system