KEGG   Ailuropoda melanoleuca (giant panda): 100464171
Entry
100464171         CDS       T01329                                 

Gene name
WNT16
Definition
(RefSeq) protein Wnt-16 isoform X1
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100464171 (WNT16)
   04390 Hippo signaling pathway
    100464171 (WNT16)
   04150 mTOR signaling pathway
    100464171 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100464171 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100464171 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100464171 (WNT16)
   05202 Transcriptional misregulation in cancer
    100464171 (WNT16)
   05205 Proteoglycans in cancer
    100464171 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100464171 (WNT16)
   05226 Gastric cancer
    100464171 (WNT16)
   05217 Basal cell carcinoma
    100464171 (WNT16)
   05224 Breast cancer
    100464171 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100464171 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    100464171 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100464171 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100464171 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100464171 (WNT16)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100464171 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100464171
NCBI-ProteinID: XP_002922471
Ensembl: ENSAMEG00000006022
UniProt: D2HJH3
LinkDB
Position
1
AA seq 362 aa
MDRAALLGLSRLCALWAALLALFPCGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELC
KRKPYLLPSIGEGARLGIQECRSQFRHERWNCLVTAASPPGTSPLFGYELSSGTKETAFI
YAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFL
DFPIRNTTGKESQVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFE
KIGHLLKDKYENSVQISDKIKRKMRRRDKDQRKIPIRKEDLLYVNKSPNYCVEDKKLGIP
GTQGRECNRTSEGAGGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHT
CK
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggacagagcggcgctcctgggactgtcgcgcctgtgcgcgctgtgggcagccctgctc
gcgctgttcccctgcggagcccaaggaaattggatgtggttgggcatcgcctcctttggg
gttccggagaagctgggctgcgccaacttgccgctgaacagccgccagaaggagctgtgc
aagaggaaaccgtacctgctgccgagcatcggagagggcgcgcggctgggcattcaggag
tgcaggagccagttcagacacgagagatggaactgcctggtcaccgccgcctccccgccg
ggcaccagccccctttttggctacgagctgagcagcggcaccaaggaaacagcatttatt
tatgctgtgatggctgcaggcctggtgcattctgtgaccaggtcctgcagcgcaggcaac
atgactgagtgttcctgcgacaccaccttacagaatggcggctcagccagcgaaggctgg
cactgggggggctgctccgatgacgtccagtatggcatgtggttcagcagaaagttccta
gatttccccatcagaaacacgacaggaaaagaaagccaagtactgttagcgatgaaccta
cacaacaacgaagctggaaggcaggccgtcgccaagctgatgtcggtagattgccgctgt
catggagtttccggctcctgcgctgtgaaaacgtgctggaaaaccatgtcctctttcgaa
aagattggccatttgttgaaggataaatatgaaaacagtgtccaaatctcagacaaaata
aagaggaaaatgcgcaggagagacaaagatcagaggaaaataccgattcgcaaggaggac
ctgctctacgttaataagtctcccaattactgcgtagaggacaagaaactggggatcccg
gggacgcaaggcagagaatgcaaccgcacgtcagagggcgcgggtggctgcaacctcctt
tgctgtggccgaggctacaacacccacgtggtcaggcacgtggagaggtgcgagtgcaag
tttatttggtgctgctacgtgcgctgcaggaggtgcgaaagcatgactgacgtccacact
tgtaagtag

KEGG   Ailuropoda melanoleuca (giant panda): 100466672
Entry
100466672         CDS       T01329                                 

Gene name
WNT8B
Definition
(RefSeq) protein Wnt-8b isoform X1
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100466672 (WNT8B)
   04390 Hippo signaling pathway
    100466672 (WNT8B)
   04150 mTOR signaling pathway
    100466672 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100466672 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100466672 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100466672 (WNT8B)
   05205 Proteoglycans in cancer
    100466672 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100466672 (WNT8B)
   05226 Gastric cancer
    100466672 (WNT8B)
   05217 Basal cell carcinoma
    100466672 (WNT8B)
   05224 Breast cancer
    100466672 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100466672 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    100466672 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100466672 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100466672 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100466672 (WNT8B)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100466672 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100466672
NCBI-ProteinID: XP_011229414
Ensembl: ENSAMEG00000006713
LinkDB
Position
6
AA seq 351 aa
MLLMKPSVCIFLFTCILRPSYTWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAW
DRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG
QLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTC
KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRS
ISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEE
RRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPGRKP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgttgcttatgaagccttctgtgtgcatcttccttttcacctgtatcctccgacccagc
tatacctggtcagtgaacaatttcctgatgactggtccaaaggcttacctgatctattcc
agcagtgtggcagctggtgcccagagtggtattgaagaatgcaagtatcagtttgcctgg
gaccgatggaactgccctgagagagccctgcagctgtctagccatggtggccttcgcagt
gctaatcgggagacagcgtttgtacacgccatcagttctgctggggtcatgtacactctg
actaggaactgcagcctgggggattttgacaactgtggctgtgacgactcccgaaatggg
cagctggggggccaaggctggctgtggggaggctgcagtgacaacgtgggcttcggagag
gcaatatccaagcagttcgtcgatgccctagagacaggacaagatgcccgggcagccatg
aacctgcacaacaatgaggccggccgcaaggcggtgaagggcaccatgaaacgcacgtgt
aagtgccacggtgtgtccggcagctgcaccacgcagacctgctggctgcagctgcctgag
ttccgcgaggtgggcgcgcacctgaaggagaagtaccacgcggctctcaaggtggacctg
ctgcagggggctggcaacagtgccgccggccgaggcgccatcgctgacaccttccgctcc
atctccacacgggagctggtgcacttggaggactccccggactactgcctggagaacaaa
acgctgggactgctgggtaccgagggccgagagtgcctacggcgcgggcgggccctgggc
cgctgggagcgccgcagctgccgccggctctgcggggactgcggcctggcggtggaggag
cgccgcgccgagaccgtgtccagctgcaactgcaagttccactggtgctgcgcggtccgc
tgcgagcagtgccgccggcgcgttaccaagtacttctgcagccgcgccgagcgaccgcgg
gggggcgcggcgcacaaacccgggagaaaaccctga

KEGG   Ailuropoda melanoleuca (giant panda): 100467643
Entry
100467643         CDS       T01329                                 

Definition
(RefSeq) protein Wnt-10a isoform X1
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100467643
   04390 Hippo signaling pathway
    100467643
   04150 mTOR signaling pathway
    100467643
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100467643
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100467643
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100467643
   05205 Proteoglycans in cancer
    100467643
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100467643
   05226 Gastric cancer
    100467643
   05217 Basal cell carcinoma
    100467643
   05224 Breast cancer
    100467643
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100467643
   05022 Pathways of neurodegeneration - multiple diseases
    100467643
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100467643
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100467643
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100467643
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100467643
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100467643
NCBI-ProteinID: XP_034508909
LinkDB
Position
Unknown
AA seq 199 aa
MGSTHPCPWLRLRPRPQPRPALCALLFFLLLLAASVPRSAPNDILGLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGSCPPHPCPSAHPKSQPSPTYSLKLSTPPAPDAHLPDILLLSGFGQSMGARQMGQ
TCLQPGLCGLRVVGSMPEN
NT seq 600 nt   +upstreamnt  +downstreamnt
atgggcagcacccacccttgcccctggctgcggctccgacctcggccccagccgcggccc
gcgctctgcgcgctcctgttcttcctactgctgctggctgcctccgtgcccaggtctgca
cccaacgacattctgggcctccgcctccccccggagcccgtgctcaatgccaacacggtg
tgcctgacattgccgggcctgagcaggaggcagatggaagtgtgtgtgcgccaccctgac
gtggctgcctcagccatccagggcatccagatcgccatccacgagtgccagcaccagttc
cgggaccagcgctggaactgctctagtctggagacccgcaacaagatcccctacgagagt
cccatcttcagcagaggtagctgcccccctcacccttgcccttctgcgcaccccaaaagc
caaccatcccctacctactccctcaagctgtcaaccccccctgccccagatgcccatcta
ccagacatactgcttctttccggttttggccagtccatgggggccagacaaatggggcag
acgtgtctccagcctgggctgtgtgggctgagggtagtaggttccatgcctgagaattga

KEGG   Ailuropoda melanoleuca (giant panda): 100467896
Entry
100467896         CDS       T01329                                 

Gene name
WNT6
Definition
(RefSeq) protein Wnt-6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100467896 (WNT6)
   04390 Hippo signaling pathway
    100467896 (WNT6)
   04150 mTOR signaling pathway
    100467896 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100467896 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100467896 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100467896 (WNT6)
   05205 Proteoglycans in cancer
    100467896 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100467896 (WNT6)
   05226 Gastric cancer
    100467896 (WNT6)
   05217 Basal cell carcinoma
    100467896 (WNT6)
   05224 Breast cancer
    100467896 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100467896 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    100467896 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100467896 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100467896 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100467896 (WNT6)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100467896 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100467896
NCBI-ProteinID: XP_034498430
LinkDB
Position
2
AA seq 288 aa
MEWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRR
WNCSSHSKAFGRILQQARVRTGSPDGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGD
IRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGA
SRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDL
SGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL
NT seq 867 nt   +upstreamnt  +downstreamnt
atggaatgggcggtgggcagccccctggtcatggaccccaccagcatctgcaggaaagcc
cggcggctggcagggcggcaggctgagctgtgccaggccgagccagaggtggtggcggag
ctagcccggggcgcccggcttggggtacgagagtgccagttccagttccgtttccgtcgc
tggaactgctccagccacagcaaggccttcgggcgcatcctgcagcaggcccgggtccgg
accggctcccccgacggcagcgccgcctgggagtggggaggctgcggcgatgacgtagac
ttcggggacgagaagtcgaggctctttatggacgcgcggcacaagcggggacggggagac
atccgcgcgttggtgcaacttcacaacaacgaggcgggccggctggccgtgcggagccat
acgcgcaccgagtgcaagtgccacgggctgtcgggctcttgcgcgctgcgaacctgctgg
cagaagctgcccccgttccgcgaggtgggcgcgcggctgctcgagcgcttccacggcgcc
tcgcgtgtcatgggaaccaacgacggcaaggctctgctgcccgcggtccgcactctcaag
ccgccgggccgcgccgacctcctctacgccgccgactcgcccgacttctgcgctcccaac
cggcgcaccggctcgcctggcacgcgcggccgcgcctgcaacagcagcgccccggacctc
agcggctgcgacctgctgtgctgcggccgcgggcaccgccaggagagcgtgcagctcgag
gagaactgcctgtgccgcttccactggtgctgcgtcgtgcagtgccaccgctgtcgcgtg
cgcaaggagctcagcctctgcctctga

KEGG   Ailuropoda melanoleuca (giant panda): 100468561
Entry
100468561         CDS       T01329                                 

Gene name
WNT11
Definition
(RefSeq) protein Wnt-11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100468561 (WNT11)
   04390 Hippo signaling pathway
    100468561 (WNT11)
   04150 mTOR signaling pathway
    100468561 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100468561 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100468561 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100468561 (WNT11)
   05205 Proteoglycans in cancer
    100468561 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100468561 (WNT11)
   05226 Gastric cancer
    100468561 (WNT11)
   05217 Basal cell carcinoma
    100468561 (WNT11)
   05224 Breast cancer
    100468561 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100468561 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    100468561 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100468561 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100468561 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100468561 (WNT11)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100468561 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100468561
NCBI-ProteinID: XP_034522202
Ensembl: ENSAMEG00000016932
LinkDB
Position
8
AA seq 354 aa
MRARPRVCEALLFALALQTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTIVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEVKCKCHGVSGSCSIRTCWKGLQELRDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSHGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggccgcgggtctgcgaggcgctcctcttcgccctggctctccagaccggc
gtgtgctacggcatcaaatggctggcgctgtccaagaccccggcggcccttgcgctgaac
cagacgcagcactgcaagcagctggaggggctggtgtcggcgcaggtgcagctctgccgc
agcaacctggagctcatgcacaccatcgtgcacgccgcccgcgaggtcatgaaggcctgc
cgcagggcctttgccgacatgcgctggaactgttcctccatcgagcttgcccccaactac
ctgcttgacctggagagagggacccgggagtcagccttcgtgtatgcgctgtcggcggcc
gccatcagccacgccatcgcccgggcctgcacctccggcgacctgcccggctgctcctgc
ggccctgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgcgcctctctggaggtgaagtgtaagtgccacggcgtgtccggctcctgctccatc
cgcacctgctggaaggggctgcaggagctccgggacgtggcggccgacctcaagacccgc
tacctgtcggccactaaggtggtgcaccgacctatgggcacccgcaaacacctggtgccc
aaggacctggatatcaggcctgtgaaggactcggagcttgtctatctgcagagctccccc
gacttctgcatgaagaacgagaaggtgggctcccatgggacgcaagacaggcagtgcaac
aagacgtcccacggcagtgacagctgtgacctcatgtgctgcggccgtggctacaacccc
tacacggaccgtgtggtcgagcgctgccactgcaagtatcactggtgctgctacgtcacg
tgccgccgctgcgagcgcacggtggagcgctacgtctgcaagtga

KEGG   Ailuropoda melanoleuca (giant panda): 100468584
Entry
100468584         CDS       T01329                                 

Gene name
WNT4
Definition
(RefSeq) protein Wnt-4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04919  Thyroid hormone signaling pathway
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100468584 (WNT4)
   04390 Hippo signaling pathway
    100468584 (WNT4)
   04150 mTOR signaling pathway
    100468584 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100468584 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100468584 (WNT4)
   04916 Melanogenesis
    100468584 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    100468584 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100468584 (WNT4)
   05205 Proteoglycans in cancer
    100468584 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100468584 (WNT4)
   05226 Gastric cancer
    100468584 (WNT4)
   05217 Basal cell carcinoma
    100468584 (WNT4)
   05224 Breast cancer
    100468584 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100468584 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    100468584 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100468584 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100468584 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100468584 (WNT4)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100468584 (WNT4)
SSDB
Motif
Pfam: wnt MEF2_binding
Other DBs
NCBI-GeneID: 100468584
NCBI-ProteinID: XP_034500903
LinkDB
Position
2
AA seq 395 aa
MSGPRRGVGSRIQRVEGCGDDLGKRTLTTPGENAVLVGSRRPGLGTARSWQWKEEEGAPR
RIPPRRLVPRYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRGAQLAIE
ECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKC
GCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNEAGRK
AILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALV
PRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFH
TALVELAERCSCKFHWCCFVKCRQCHRLVELHTCR
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgtcggggccacgtcggggagtgggcagcaggattcagagagttgaggggtgtggtgac
gacctggggaagcggacactgaccacccccggggagaacgcggtgctggttggttcccgg
agacctgggctgggtacagcccggtcctggcagtggaaagaggaggagggagcgccgcgt
cgcattccaccccgccgccttgtccccaggtacctggccaagctgtcgtcggtggggagc
atctcggaggaggagacatgcgagaagctcaagggcctgatccagaggcaggtgcagatg
tgcaagcggaacctggaggtgatggactcggtgcgccgcggcgctcagctggccatcgag
gagtgccagtaccagttccggaaccggcgctggaactgctccacgctcgactccctgcct
gtcttcggcaaggtggtgacacaagggactcgggaggccgccttcgtgtacgccatctct
tcggcaggtgtggccttcgcggtgacgcgggcgtgcagcagcggggagctggagaagtgt
ggctgcgaccggacggtgcatggggtcagcccgcagggcttccagtggtcaggatgctcg
gacaacattgcctacggcgtggccttctcccagtccttcgtggatgtgcgggagagaagc
aagggggcctcatccagccgcgccctcatgaacctccacaacaacgaggccggcaggaag
gctatcctgacacacatgcgggtggagtgcaagtgccacggggtgtcgggctcctgtgag
gtaaagacgtgctggcgagccgtgccgcccttccgccaggtgggccatgccttgaaggag
aagtttgacggcgccacggaggtggagccgcgccgcgtgggctcctccagggcgctggtg
cctcgcaacgcacagttcaagccgcacacggacgaggacctggtgtatctggagcccagc
ccggacttctgcgagcaggacatgcgcagcggcgtgctgggcacgcggggccgcacgtgc
aacaagacatccaaggccatcgatggctgtgagctgctatgctgcggccgcggcttccac
acagcgctggtggagctggccgagcgctgcagctgcaagttccactggtgctgcttcgtc
aagtgccgccagtgccatcggctggtggagctgcacacgtgccggtga

KEGG   Ailuropoda melanoleuca (giant panda): 100471555
Entry
100471555         CDS       T01329                                 

Gene name
WNT3
Definition
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100471555 (WNT3)
   04390 Hippo signaling pathway
    100471555 (WNT3)
   04150 mTOR signaling pathway
    100471555 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100471555 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100471555 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100471555 (WNT3)
   05206 MicroRNAs in cancer
    100471555 (WNT3)
   05205 Proteoglycans in cancer
    100471555 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100471555 (WNT3)
   05226 Gastric cancer
    100471555 (WNT3)
   05217 Basal cell carcinoma
    100471555 (WNT3)
   05224 Breast cancer
    100471555 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100471555 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    100471555 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100471555 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100471555 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100471555 (WNT3)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100471555 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100471555
NCBI-ProteinID: XP_002928823
Ensembl: ENSAMEG00000004256
UniProt: G1LC69
LinkDB
Position
13
AA seq 355 aa
MEPHLLGLLLGLLLCGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctcctcggcctcctgctctgtggcaccagggtcctc
gccggctacccaatttggtggtccctggccctgggccagcagtacacatccctgggctca
cagcccctgctctgcggctccatcccaggcctggtccctaagcaactgcgcttctgccgg
aattacatcgaaataatgcccagcgtggccgagggcgtgaagctgggcatccaggagtgc
cagcaccagttccggggccgccgctggaactgcaccaccatagacgacagcctggccatc
ttcgggcccgtcctggacaaagccacccgcgagtcggccttcgtgcacgccatcgcctct
gccggcgtggccttcgccgtcacgcgctcctgtgccgagggcacctccaccatctgcggc
tgcgactcgcaccacaaggggccgcctggcgagggctggaagtggggcggctgcagcgag
gatgccgacttcggggtgctcgtgtcccgggagttcgcggacgcgcgcgagaacaggccg
gacgcgcgctcggccatgaacaagcacaacaacgaggcgggccgcacgaccatcctggac
cacatgcacctcaaatgcaagtgccacgggctgtcgggcagctgcgaggtcaagacgtgc
tggtgggcccagcccgacttccgcgctatcggcgacttcctcaaggacaagtacgacagt
gcctcggagatggtggtggaaaagcaccgcgagtcccgcggctgggtggagaccctccgc
gccaagtacgcgctgttcaagccgcccaccgagagggacctggtctactacgagaactcc
cccaacttctgcgagcccaaccctgagacgggctcctttggcaccagggatcggacttgc
aatgtcacctcccacggcattgatggctgtgacctgctgtgctgtggccgcggccacaac
acgaggacggagaagcggaaggagaaatgccactgcatcttccactggtgctgctatgtg
agctgccaggagtgcatccggatctacgatgtgcacacctgcaagtag

KEGG   Ailuropoda melanoleuca (giant panda): 100472460
Entry
100472460         CDS       T01329                                 

Gene name
WNT9B
Definition
(RefSeq) protein Wnt-9b
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100472460 (WNT9B)
   04390 Hippo signaling pathway
    100472460 (WNT9B)
   04150 mTOR signaling pathway
    100472460 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100472460 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100472460 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100472460 (WNT9B)
   05205 Proteoglycans in cancer
    100472460 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100472460 (WNT9B)
   05226 Gastric cancer
    100472460 (WNT9B)
   05217 Basal cell carcinoma
    100472460 (WNT9B)
   05224 Breast cancer
    100472460 (WNT9B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100472460 (WNT9B)
   05022 Pathways of neurodegeneration - multiple diseases
    100472460 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100472460 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100472460 (WNT9B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100472460 (WNT9B)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100472460 (WNT9B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100472460
NCBI-ProteinID: XP_034496594
LinkDB
Position
13
AA seq 561 aa
MAGPLGSKAEWPQHWEDVTEAMMGHGQATCVNLRVQEQLWYLGEENLERPSTPPKCGDSL
VSAWDLHPRLSRPAGLQVPPARPRRAPRQRSELRLASPPPAWIAPSGVPLSVLFAAALPT
LTCPRPHPTHSARPRTPAPSCQTLHTFRTLAPSAPRSRSLPVQASLSRSDALSGSSLRAL
SARNSVQSAYCVTMQGSSSYKELQRCGIQPEVQAGSGGSKRESRGLGSMGLTGREVLTPF
PGLGTAAAPAQDGAHLKQCDLLKLSRRQKQLCRREPGLAETLQDAAHLSLLECQFQFRHE
RWNCSLEGRTGLLKRGFKETAFLYAVSSAALTHTLARACSAGRMERCTCDDSPGLESRQA
WQWGVCGDNLKYSTKFLSHFLGPKRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVS
GSCAVRTCWKQLSPFRETGQALKLRYDSAVKVSSATNEALGRLELWAPARPGSPTKGLAP
RPGDLVYMEDSPSFCRPSKYSPGTAGRVCSREASCGSLCCGRGYDTQSRLVAFSCHCQVQ
WCCYVECQQCVREELVYTCKP
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggcggggccactgggctccaaagcggaatggccacagcactgggaggatgtcacggag
gccatgatgggccacgggcaggctacctgtgtgaacctgcgggtccaggagcagctgtgg
tacctcggggaagagaatcttgagcgtccctccaccccgccgaaatgcggagactccctg
gtctccgcctgggacctgcatccccgcctctccaggcccgcgggcctccaagttccgccg
gcgcgcccccggcgggcgccgcgtcagcgcagcgagctccgtctggcttccccgcctccg
gcctggatcgccccgtctggtgtcccactctcggtcctcttcgccgccgcccttcccacc
ctgacctgtccaagacctcatcctacccactccgcccggcctcggaccccggccccgagc
tgccagactctgcacacgtttcggaccctggccccatccgcgccgcgctcccggtccctg
ccggtccaggcgtccctctcgcgctccgatgccctctctggatcctcacttcgcgccctg
tctgctcggaacagtgtgcagagcgcatactgtgtcaccatgcaggggagcagcagctac
aaggagctgcagaggtgtggcatccagccagaagtccaggctgggtcaggcggctccaag
cgggagagccgtggcctcggctccatgggcctgaccgggcgggaggtcctgacgcccttc
ccagggctgggcaccgccgcggcccccgcacaggatggggcccacctgaaacagtgtgac
ttgctgaagctgtcccggcggcagaagcagctgtgccggagggagcctggcctggccgag
accctgcaggacgctgctcacctcagcctgctcgagtgccagttccagttccgccacgag
cgctggaactgcagcctggaggggaggacgggcctgctcaagagaggtttcaaggagacg
gccttcctgtacgcagtgtcctcggccgccctcacccacactctggcccgggcctgcagc
gccggccgcatggagcgctgcacctgtgacgactccccgggcctggagagccggcaggcc
tggcagtggggtgtgtgcggcgacaacctcaagtacagcaccaagttcctgagccacttc
ctggggcccaagcgaggaagcaaagacctgagggcccgggcggatgctcacaacacccac
gtgggcatcaaggcagtgaagagtggcctcaggaccacgtgtaagtgccacggcgtgtcg
ggctcctgcgccgtgcgcacctgctggaagcagctctcccccttccgcgagacgggtcag
gcgctcaagctgcgctatgactcagccgtcaaggtgtccagtgccaccaacgaggccttg
ggccgcctggagctgtgggcccctgcccggccaggcagccccaccaagggcctggccccg
cggcctggggacctggtctacatggaagactcgcccagtttctgccggcccagcaagtac
tcgcccggcacagcgggcagggtgtgttcgcgggaggccagctgcggcagcctgtgctgc
gggcggggctacgacacccagagccgcctggtggccttctcctgccactgccaggtgcag
tggtgctgctacgtggagtgccagcagtgcgtgcgggaggagctcgtgtacacctgcaag
ccctag

KEGG   Ailuropoda melanoleuca (giant panda): 100473835
Entry
100473835         CDS       T01329                                 

Gene name
WNT3A
Definition
(RefSeq) protein Wnt-3a
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100473835 (WNT3A)
   04390 Hippo signaling pathway
    100473835 (WNT3A)
   04150 mTOR signaling pathway
    100473835 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100473835 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100473835 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100473835 (WNT3A)
   05206 MicroRNAs in cancer
    100473835 (WNT3A)
   05205 Proteoglycans in cancer
    100473835 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100473835 (WNT3A)
   05226 Gastric cancer
    100473835 (WNT3A)
   05217 Basal cell carcinoma
    100473835 (WNT3A)
   05224 Breast cancer
    100473835 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100473835 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    100473835 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100473835 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100473835 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100473835 (WNT3A)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100473835 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100473835
NCBI-ProteinID: XP_002929379
Ensembl: ENSAMEG00000016308
UniProt: G1MCZ8
LinkDB
Position
3
AA seq 352 aa
MALLGYFLFLYGLKQALGSYPIWWSLAVGPQYSSLATQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKISIEECQHQFRGRRWNCTTVNNSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGSAAICGCSSRHQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECARVYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccctgctcggatacttcttattcctctacggcctgaagcaggcgctgggcagctac
ccgatctggtggtccctggccgtcggaccccaatactcatccctggccactcagcccatc
ctgtgcgccagcatccctggcctggtccccaagcagctgcgcttctgccggaactacgtg
gagatcatgcccagcgtggcagagggcattaagatcagcatcgaggagtgccagcaccag
ttccgtgggcgccgctggaactgcaccacggtcaacaacagcctggccatcttcggccct
gtgctggacaaagccacccgggagtcagccttcgtgcacgccattgcctctgccggcgtg
gccttcgctgtgacacgctcgtgtgccgagggctccgcggccatatgtggctgcagcagc
cgccaccagggctctccaggcgagggctggaagtggggtggctgcagcgaggacatcgag
tttggcggcatggtgtctcgagagtttgcagatgcgcgggagaaccggccagatgcccgc
tccgcaatgaaccgccacaacaacgaggccggtcgccaggccatcgccagccacatgcat
ctcaagtgcaagtgccacgggctgtcgggcagctgcgaggtgaagacctgctggtggtcg
cagcccgacttccgcgccatcggcgacttcctcaaggacaaatacgacagcgcctcggag
atggtggtggagaagcaccgcgagtcgcgcggctgggtggagaccctgcggccgcgctac
acctacttcaaggtgcccacggagcgtgacctggtgtactacgaggcctcgcccaacttc
tgcgagcccaaccccgagaccggctcgtttggcacccgcgaccgcacgtgcaacgtgagt
tcgcacggcattgacggctgcgacctgctgtgctgcggccgcggccacaacgcgcggacc
gagcggcgccgcgagaagtgccactgcgtcttccactggtgctgctacgtgagctgccag
gagtgcgcgcgcgtctacgacgtgcacacctgcaaatag

KEGG   Ailuropoda melanoleuca (giant panda): 100473854
Entry
100473854         CDS       T01329                                 

Gene name
WNT5B
Definition
(RefSeq) protein Wnt-5b isoform X3
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100473854 (WNT5B)
   04390 Hippo signaling pathway
    100473854 (WNT5B)
   04150 mTOR signaling pathway
    100473854 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100473854 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100473854 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    100473854 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100473854 (WNT5B)
   05205 Proteoglycans in cancer
    100473854 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100473854 (WNT5B)
   05226 Gastric cancer
    100473854 (WNT5B)
   05217 Basal cell carcinoma
    100473854 (WNT5B)
   05224 Breast cancer
    100473854 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100473854 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    100473854 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100473854 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100473854 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100473854 (WNT5B)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100473854 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100473854
NCBI-ProteinID: XP_019649301
Ensembl: ENSAMEG00000004263
LinkDB
Position
16
AA seq 329 aa
MNPVQRPEMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMAYIGEGAKTGIKECQYQFRQR
RWNCSTVDNASVFGRVMQIGSRETAFTYAVSAAGVVNAISRACREGELSTCGCSRSARPK
DLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRVLMNLQNNEAGRRAVY
RMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDQLKEKYDSAAAMRITRRGKLELVNSRF
NQPTPEDLVYVDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKSVQ
VERCHCKFHWCCYVKCKKCTEIVDQYVCK
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaacccggtgcagagacccgagatgtttatcatcggtgcccagcccgtgtgcagccag
cttcctgggctctcccctggccagaggaagctgtgccaactgtaccaggagcacatggcc
tatattggggagggagccaagacgggcatcaaggagtgccagtaccagttccggcagcgg
cggtggaactgtagcacggtggacaacgcgtctgtcttcgggagagtcatgcagataggg
agccgggagaccgccttcacctacgcggtgagcgccgccggggtggtgaacgccatcagc
cgggcttgcagggagggggagctctccacgtgcggctgcagccggtcggcgcggcccaag
gaccttccccgggactggctgtggggcggctgcggggacaacgtggagtacggctaccgc
tttgctaaggagttcgtggatgcccgcgagcgggagaagaactttgccaaggggtcggag
gagcaaggccgagtgctcatgaacctgcagaacaacgaggcggggcggagggcggtgtac
aggatggccgacgtggcctgcaaatgccacggcgtctcggggtcctgcagcctcaagacg
tgctggctgcagctggctgagttccgcaaggtgggggaccagctgaaggagaagtacgac
agcgcggccgccatgcgcatcacccgcaggggcaagctggagctggtcaacagccgcttc
aaccagcccaccccggaggacctggtctacgtggaccccagcccagactactgcctgcgc
aacgagaccaccggctcgctgggcacgcagggccgcctgtgcaacaagacgtcggagggc
atggacggctgcgagctcatgtgctgcggccgcggctacgaccagttcaagagcgtgcag
gtggagcgctgccactgcaaattccactggtgctgctacgtcaagtgcaagaagtgcacg
gagatcgtcgaccagtacgtctgtaaatag

KEGG   Ailuropoda melanoleuca (giant panda): 100474982
Entry
100474982         CDS       T01329                                 

Gene name
WNT7B
Definition
(RefSeq) protein Wnt-7b
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100474982 (WNT7B)
   04390 Hippo signaling pathway
    100474982 (WNT7B)
   04150 mTOR signaling pathway
    100474982 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100474982 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100474982 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100474982 (WNT7B)
   05205 Proteoglycans in cancer
    100474982 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100474982 (WNT7B)
   05226 Gastric cancer
    100474982 (WNT7B)
   05217 Basal cell carcinoma
    100474982 (WNT7B)
   05224 Breast cancer
    100474982 (WNT7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100474982 (WNT7B)
   05022 Pathways of neurodegeneration - multiple diseases
    100474982 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100474982 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100474982 (WNT7B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100474982 (WNT7B)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100474982 (WNT7B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100474982
NCBI-ProteinID: XP_034500095
Ensembl: ENSAMEG00000003444
LinkDB
Position
15
AA seq 360 aa
MLLLSPRGALLSVYCPQIFLILSSGSYLALSSVVALGANIICNKIPGLAPRQRAICQSRP
DAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVA
HAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNA
RRLMNLHNNEAQEGRAGAGRGVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREVGHMLK
EKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGT
QGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgctcctgctgtcgccgcgcggcgcgctcctctccgtgtactgcccgcagatctttctc
atcctgtccagcggcagctacctagcgctgtcgtccgtcgtggccctgggagccaacatc
atctgcaacaagattcctggcttggccccgcggcagcgcgccatctgccagagccggccc
gatgccatcatcgtgatcggggagggggcacagatgggcatcaacgagtgtcagtaccag
ttccgcttcggccgctggaactgctccgccctcggcgagaagaccgtcttcgggcaagag
ctccgagtagggagccgcgaggccgccttcacctatgccatcaccgcggccggggtggcc
cacgccgtcacggccgcctgcagccagggtaacctgagcaactgcgggtgcgaccgcgag
aagcagggctactacaaccaggccgagggctggaagtggggcggctgctccgccgacgtg
cgttacggcatcgacttctcccggcgcttcgtggacgcccgtgagatcaagaagaacgcg
cgacgcctcatgaacctgcacaacaacgaggctcaggaaggtagggcaggcgccgggcgg
ggggtcctggaggagcgcatgaagctggagtgcaaatgccacggcgtgtcgggctcgtgc
accaccaagacgtgctggaccacgctgcccaagttccgcgaggtgggccacatgctcaag
gagaagtacaacgcggccgtgcaggtggaggtggtgcgggccagccgcctgcggcagccc
accttcctgcgcatcaagcagctgcgcagctaccagaagcccatggagacggacctggtg
tacatcgagaagtcgcccaactactgcgaggaggacgcggccacgggcagcgtgggcacg
cagggccgcctgtgcaaccgcacgtcgccgggcgcggatggctgcgacaccatgtgctgc
ggccgcggctacaacacgcaccagtacaccaaagtgtggcagtgcaactgcaagttccac
tggtgctgcttcgtcaagtgtaacacctgcagcgagcgcaccgaggtcttcacctgcaag
tga

KEGG   Ailuropoda melanoleuca (giant panda): 100475007
Entry
100475007         CDS       T01329                                 

Gene name
WNT1
Definition
(RefSeq) proto-oncogene Wnt-1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100475007 (WNT1)
   04390 Hippo signaling pathway
    100475007 (WNT1)
   04150 mTOR signaling pathway
    100475007 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100475007 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100475007 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475007 (WNT1)
   05205 Proteoglycans in cancer
    100475007 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100475007 (WNT1)
   05226 Gastric cancer
    100475007 (WNT1)
   05217 Basal cell carcinoma
    100475007 (WNT1)
   05224 Breast cancer
    100475007 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100475007 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    100475007 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100475007 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100475007 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100475007 (WNT1)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100475007 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100475007
NCBI-ProteinID: XP_002927238
Ensembl: ENSAMEG00000007017
LinkDB
Position
16
AA seq 370 aa
MGHWALLPGWVSATLWLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTASGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggcactgggcgctgctgcccggctgggtttctgctacgctgtggctggcgctggcc
gctctgcctgcagccctggccgccaacagcagtggccgatggtggggcatcgtgaacgta
gcctcctccacgaacctgctgaccgactccaagagtctacaactggtgctcgagcccagt
cttcagctgctgagccgcaaacagcggaggctgatccgccagaacccggggatcctgcac
agcgtgagcggggggctgcagagcgctgtgcgagagtgcaaatggcagttccgcaaccgc
cgctggaactgccccacggcttcggggccccacctcttcggcaagatcgtcaaccgaggc
tgccgggaaacggcctttatcttcgccatcacctccgccggggttacgcattcagtggca
cgctcctgctcagagggctccatcgagtcctgcacgtgcgactaccggcggcggggtccg
gggggccccgattggcactgggggggatgcagcgacaacatcgacttcggccgcctcttc
ggcagggagtttgtggactccggggagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggcgggccgcacgaccgtgttctccgagatgcgccaggagtgcaagtgc
cacgggatgtcgggctcgtgcacggtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtgggcgacgtgctgcgcgaccgattcgatggcgcctcgcgcgtcctctacggcaac
cgcggcagcaatcgcgcctcgcgggcggaactgctgcgcctggagcccgaagaccccgct
cacaagccgccctcaccccacgacctcgtctactttgagaaatcgcccaatttctgcaca
tacagcggacgcctggggacagccggcacggcggggcgcgcctgcaacagctcgtcgccc
gcgctggacggctgcgagctgctctgctgtggacggggccaccgcacgcgcacacagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctgtga

KEGG   Ailuropoda melanoleuca (giant panda): 100475103
Entry
100475103         CDS       T01329                                 

Gene name
WNT9A
Definition
(RefSeq) protein Wnt-9a isoform X1
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100475103 (WNT9A)
   04390 Hippo signaling pathway
    100475103 (WNT9A)
   04150 mTOR signaling pathway
    100475103 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100475103 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100475103 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475103 (WNT9A)
   05205 Proteoglycans in cancer
    100475103 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100475103 (WNT9A)
   05226 Gastric cancer
    100475103 (WNT9A)
   05217 Basal cell carcinoma
    100475103 (WNT9A)
   05224 Breast cancer
    100475103 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100475103 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    100475103 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100475103 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100475103 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100475103 (WNT9A)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100475103 (WNT9A)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 100475103
NCBI-ProteinID: XP_034511653
LinkDB
Position
3
AA seq 394 aa
MSDVVPFWPGLLHRSLPQTIRALGAHCAGQSSVCVCVCVCVCVCVGVCLWGGPHPSLSVP
RLTGSEPLTILPLTLEPEAAAQAHYKACDRLKLERKQRRMCRRDPGVAETLVEAVSMSAL
ECQYQFRFERWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKACSAGRMERCTC
DEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNLVGVKVIKAGV
ETTCKCHGVSGSCTVRTCWRQLAPFHEVGKRLKHKYETALKVGSTTNEATGEAGAISPPR
GRAAVTGSSDPLPRTPELVHLDDSPSFCLASRFSPGTAGRRCHREKNCESICCGRGHNTQ
SRVVTRPCQCQVRWCCYVECRQCTQREEVYTCKG
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgtcggatgtggtccccttttggcctgggctcctgcaccgctccctgccccaaaccatc
cgcgcccttggtgcacactgtgctgggcagtcctccgtgtgtgtgtgtgtgtgtgtgtgt
gtgtgtgtgtgtgtcggcgtttgcctctggggcggccctcaccctagcctctctgtaccc
aggcttacgggcagcgagcccctgaccatcctcccgctgaccctggagccggaggccgcc
gcccaggcacactacaaggcctgtgaccggctgaagctggagcgcaagcagagacgcatg
tgtcgccgggacccaggcgtggccgagactctggtggaggcggtcagcatgagcgctctg
gagtgccagtaccagttccggttcgagcgctggaactgcactttggagggccgttaccgg
gccagcctgctcaagcgaggcttcaaggagaccgccttcctctatgccatctcgtcggcc
ggcctgacgcacgcgctggccaaggcgtgcagcgcgggccgcatggagcgctgcacgtgc
gacgaagcccccgacctggagaaccgcgaagcctggcagtggggtggctgcggggataac
ctcaagtacagcagcaagttcgtcaaggagttcctgggccggcggtcgagcaaagacctg
cgagcccgcgtggacttccacaacaacctcgtgggtgtgaaggtaatcaaggctggggtg
gagaccacgtgcaagtgccacggtgtgtcgggctcctgcaccgtgcggacatgctggcgg
cagctggctcccttccacgaggtgggcaagcgcctgaaacacaagtacgagacagcactc
aaggtgggcagcaccaccaacgaggccaccggtgaggccggtgccatctccccgcctcgg
ggccgggcagcagtgacaggcagcagcgacccgctgccccgcacaccagagcttgtgcac
ctggatgactcacccagtttctgcctggccagccgcttctccccaggcactgccggccgc
aggtgccaccgggagaagaactgtgagagcatctgctgtgggcgtggccacaacacacag
agtcgggtggtgactcggccctgccagtgccaggttcgctggtgctgctacgtggagtgc
aggcagtgcacacagcgcgaggaggtctacacctgcaagggctga

KEGG   Ailuropoda melanoleuca (giant panda): 100475153
Entry
100475153         CDS       T01329                                 

Gene name
WNT7A
Definition
(RefSeq) protein Wnt-7a isoform X1
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100475153 (WNT7A)
   04390 Hippo signaling pathway
    100475153 (WNT7A)
   04150 mTOR signaling pathway
    100475153 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100475153 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100475153 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475153 (WNT7A)
   05205 Proteoglycans in cancer
    100475153 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100475153 (WNT7A)
   05226 Gastric cancer
    100475153 (WNT7A)
   05217 Basal cell carcinoma
    100475153 (WNT7A)
   05224 Breast cancer
    100475153 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100475153 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    100475153 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100475153 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100475153 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100475153 (WNT7A)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100475153 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 100475153
NCBI-ProteinID: XP_002920735
Ensembl: ENSAMEG00000009484
UniProt: G1LSD5
LinkDB
Position
4
AA seq 349 aa
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEVYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggtggcttctcctcggtggtagctctgggcgcgagcatcatctgtaacaag
atcccgggcctggctcccagacagcgggcgatctgccagagccgacccgacgccatcatc
gtcataggagaaggctcgcaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgctggaactgctcagcactgggggagcgcaccgtcttcgggaaggagctcaaagtgggg
agccgggaggctgccttcacgtacgccatcattgctgccggcgtggcccacgccatcaca
gctgcctgtacccaaggcaacctgagtgactgtggctgcgacaaggagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcccggactctcatg
aacttacacaataacgaggcaggccgaaagatcctggaggagaacatgaagctggagtgt
aagtgccatggtgtgtccggatcgtgcaccaccaagacgtgctggaccaccctgccgcag
ttccgggagctgggctacgtgctcaaggacaagtacaacgaggcggtccacgtggagccc
gtgcgcgccagccgcaacaagcggcccaccttcctgaagatcaagaagccgctgtcgtac
cgcaagcccatggacacggacctggtgtacatcgaaaagtcgcccaactactgcgaggag
gacccggtgacgggcagcgtgggcacgcagggccgcgcctgcaacaagacggccccgcag
gccagcggctgcgacctcatgtgctgcggccgcggctacaacacccaccagtacgcccgc
gtgtggcagtgcaactgcaagttccactggtgctgttacgtcaagtgcaacacctgcagc
gagcgcaccgaggtgtacacgtgcaagtga

KEGG   Ailuropoda melanoleuca (giant panda): 100475265
Entry
100475265         CDS       T01329                                 

Gene name
WNT10B
Definition
(RefSeq) protein Wnt-10b isoform X1
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100475265 (WNT10B)
   04390 Hippo signaling pathway
    100475265 (WNT10B)
   04150 mTOR signaling pathway
    100475265 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100475265 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100475265 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475265 (WNT10B)
   05205 Proteoglycans in cancer
    100475265 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100475265 (WNT10B)
   05226 Gastric cancer
    100475265 (WNT10B)
   05217 Basal cell carcinoma
    100475265 (WNT10B)
   05224 Breast cancer
    100475265 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100475265 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    100475265 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100475265 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100475265 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100475265 (WNT10B)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100475265 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100475265
NCBI-ProteinID: XP_034501484
Ensembl: ENSAMEG00000007028
LinkDB
Position
16
AA seq 410 aa
MVEWCLPRSIRPPGPSGPGFDMPEEPRPRPPPSGFAGLLFLALCSRALSNEILGLKLPGE
PPLTANTVCLTLSGLSKRQLGLCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEG
GGRLPHHSAILKRGFRESAFSFSMLAAGVMHAVATACSLGRLVSCGCSWKGSGEQDRLRA
KLLQLQALSRGKSFPHSLPSPGPGSGPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREA
PRDIQARMRIHNNRVGRQVVTENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERL
GRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKSPDFCERDPTVGSPGTRGRACNKTSR
LLDGCGSLCCGRGHNMLRQTRVERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggtggagtggtgtttgccccgatcgatccgcccaccggggccttcgggcccgggcttc
gacatgccggaggagccccggccgcggcctccgccctcgggcttcgcgggtctcctgttc
ctggcattgtgcagtcgggccctcagcaatgagattctgggcctgaagctgcccggcgag
ccgccgctgaccgccaacactgtatgcttgacgctgtcgggcctgagcaagcggcagctg
ggcctctgcctgcgcagccccgacgtgacggcatccgcgcttcagggcctgcacatcgcg
gtccacgagtgtcagcaccagctgcgcgaccagcgctggaactgctcggcgctcgagggc
ggcggccgcctgccgcaccacagcgccatcctcaagcgcggtttccgtgagagtgctttt
tccttctccatgctggcggcaggggtcatgcacgcggtcgccacggcctgcagcctgggc
aggctagtgagctgtggctgcagctggaagggcagtggtgagcaggaccggctgagggcc
aagctgctgcagctgcaggctctgtcccggggcaagagtttcccccactccctgcccagc
cccggccctggctcaggccccagccccggcccccaggacacgtgggaatggggtggctgt
aaccatgacatggactttggagagaagttctctcgggatttcttggattccagggaagct
ccccgggacatccaggcaagaatgcgaatccacaacaacagggtggggcgacaggtggta
actgaaaacctgaagcggaaatgcaagtgtcacggcacgtcgggcagctgccagttcaag
acgtgctggagggcggccccggagttccgggcagtgggggcggcgttgagggagcggctg
ggtcgggccatcttcatcgatacccacaaccgcaactccggagccttccagccccgcctg
cgcccccgtcgcctctcaggagagctggtttactttgaaaagtctcccgacttctgtgag
cgagaccctaccgtggggtcccccggcactcggggccgcgcctgcaacaagaccagccgt
ctgctggacggctgtggcagcctgtgctgtggccgtgggcacaacatgctccggcagacg
cgggtcgagcgctgtcattgccgcttccactggtgctgctacgtgctgtgcgatgagtgc
aaggtcacagagtgggtcaacgtgtgtaagtga

KEGG   Ailuropoda melanoleuca (giant panda): 100480237
Entry
100480237         CDS       T01329                                 

Gene name
WNT2
Definition
(RefSeq) protein Wnt-2 isoform X1
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100480237 (WNT2)
   04390 Hippo signaling pathway
    100480237 (WNT2)
   04150 mTOR signaling pathway
    100480237 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100480237 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100480237 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100480237 (WNT2)
   05205 Proteoglycans in cancer
    100480237 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100480237 (WNT2)
   05226 Gastric cancer
    100480237 (WNT2)
   05217 Basal cell carcinoma
    100480237 (WNT2)
   05224 Breast cancer
    100480237 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100480237 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    100480237 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100480237 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100480237 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100480237 (WNT2)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100480237 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100480237
NCBI-ProteinID: XP_019653263
Ensembl: ENSAMEG00000001256
LinkDB
Position
1
AA seq 360 aa
MNAPLGGIWLWLPLLLTWLTPEVSSSWWYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPD
VMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHGLFGRVLLRSSRESAFVYAVSSAGVV
FAITRACSQGELKSCSCDPKKKGTAKDSKGNFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDRDAGSPGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSADWAAPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcccctctcggtggaatctggctctggctccctctgctcttgacctggctcacc
cctgaggtcagctcttcatggtggtacatgagagctacaggtggctcctccagggtgatg
tgtgacaatgtgccaggcctggtgagccgccagcggcagctgtgccaccggcacccagat
gtgatgcgggccattggcctgggcgtggccgagtggacagcggagtgccagcaccagttc
cgccagcaccgctggaactgcaacacgctggaccgggatcacggcctctttggcagggtc
ctgctccgaagtagtcgggaatctgcctttgtttacgccgtctcctcagctggagttgtg
tttgccatcaccagggcctgtagccaaggagaactaaaatcctgttcctgtgatccaaag
aagaagggaaccgccaaggacagcaagggcaatttcgactggggtggctgcagtgataac
attgactatgggatcaaatttgcccgagcctttgtggatgccaaggagaggaagggaaag
gatgccagagccctgatgaaccttcacaacaacagagccggcaggaaggcggtaaagcgg
ttcttgaaacaggaatgcaagtgtcacggcgtgagtggctcgtgtactctgcggacgtgc
tggctggccatggccgacttcagaaaaacaggcgattacctctggaggaagtacaacggg
gccatccaggtcgtcatgaaccaggacggcactggtttcactgtggctaacaagaggttt
aagaagccaacaaaaaatgacctcgtgtattttgagaattctccagactattgtatcagg
gaccgagatgcaggctccccggggacagcaggccgcgtgtgcaacctgacttcccgcggc
atggacagctgcgaagtcatgtgctgcgggagaggctacgacacctcccacgtcacccgg
atgaccaagtgcgagtgtaagttccactggtgctgtgccgtgcgctgtcaggactgtctg
gaggccctggacgtgcacacgtgcaaggcccccaagagcgctgactgggctgctcccaca
tga

KEGG   Ailuropoda melanoleuca (giant panda): 100481665
Entry
100481665         CDS       T01329                                 

Gene name
WNT2B
Definition
(RefSeq) protein Wnt-2b isoform X1
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100481665 (WNT2B)
   04390 Hippo signaling pathway
    100481665 (WNT2B)
   04150 mTOR signaling pathway
    100481665 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100481665 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100481665 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100481665 (WNT2B)
   05205 Proteoglycans in cancer
    100481665 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100481665 (WNT2B)
   05226 Gastric cancer
    100481665 (WNT2B)
   05217 Basal cell carcinoma
    100481665 (WNT2B)
   05224 Breast cancer
    100481665 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100481665 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    100481665 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100481665 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100481665 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100481665 (WNT2B)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100481665 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100481665
NCBI-ProteinID: XP_002918296
Ensembl: ENSAMEG00000003598
UniProt: G1LA82
LinkDB
Position
2
AA seq 393 aa
MLKPGSAEDAAQLPPRRTRAPVPALAPGPAAPDGSRASARLGLACLLLLLLLTLPARVDT
SWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNC
TTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHD
QRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECK
CHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRRATRTD
LVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECK
FHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgctgaagccgggtagtgcggaggacgccgcgcagctcccccctcggcgcacccgcgcc
cccgtccccgcgctcgcgccaggacccgctgcccccgacggctctcgggcttcggcccgc
ctcggtctcgcctgcctgctgctgctgctgctgctgacgctgccggcccgcgtagacaca
tcctggtggtacatcggggcactgggggcccgagtgatctgtgacaatatccctggtctg
gtgagccggcagcggcagctgtgccagcgttacccagacatcatgcgctcagtgggcgag
ggtgcccgagaatggatccgagagtgtcagcaccagttccgccaccaccgctggaactgc
accacgctggaccgggaccacactgtctttgggcgcgtcatgctcagaagcagccgggag
gcagcatttgtatatgccatctcgtcggcaggggtggtccatgctatcacccgtgcctgc
agccagggtgaactgagtgtgtgcagctgtgacccctacactcgtggccgacaccatgac
caacgtggggattttgactggggtggctgcagtgacaacatccactatggtgttcgcttt
gccaaggcctttgtggatgccaaggaaaagaggcttaaggatgcccgggccctcatgaat
ttacataacaaccgctgtggtcgcacggctgtgaggcggtttctgaaactcgagtgcaag
tgccacggcgtaagtggctcctgtaccctgcgcacctgctggcgtgcactctcagacttc
cgccgcacgggtgactatctgcggcggcgctatgatggcgccgtgcaggtgacagcaacc
caggatggcgccaacttcacggcagcccgccaaggctatcgccgtgccacccggactgac
cttgtctactttgacaactccccagactactgtgtcttggacaaggctgcaggttcccta
ggcactgcgggccgtgtctgcagcaagacatctaaagggacggatggttgcgaaatcatg
tgctgtggccgagggtatgacacaactcgagtcacccgcgtcacccagtgtgagtgcaaa
ttccactggtgctgtgcggtgcggtgcaaggagtgcagaaacactgtcgacgtccatact
tgcaaggcccccaagaaggcagagtggctggaccagacctga

KEGG   Ailuropoda melanoleuca (giant panda): 100481684
Entry
100481684         CDS       T01329                                 

Gene name
WNT8A
Definition
(RefSeq) LOW QUALITY PROTEIN: protein Wnt-8a
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100481684 (WNT8A)
   04390 Hippo signaling pathway
    100481684 (WNT8A)
   04150 mTOR signaling pathway
    100481684 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100481684 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100481684 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100481684 (WNT8A)
   05205 Proteoglycans in cancer
    100481684 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100481684 (WNT8A)
   05226 Gastric cancer
    100481684 (WNT8A)
   05217 Basal cell carcinoma
    100481684 (WNT8A)
   05224 Breast cancer
    100481684 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100481684 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    100481684 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100481684 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100481684 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100481684 (WNT8A)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100481684 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100481684
NCBI-ProteinID: XP_002922769
Ensembl: ENSAMEG00000016381
LinkDB
Position
3
AA seq 351 aa
MGDLFMLRVAVGICYATFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAW
ERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYTITKNCSMGDFENCGCDESKNG
KTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRAIMKRTC
KCHGISGSCSIQTCWLQLADFREMGDYLKAKYDRALKIEMDKRQLRAGNSAEGRWAPTEA
FLPSAEAELIFLEESPDYCTRNSSLGIHGTEGRECLQNSHNTSRWEQRSCGRLCTECGLQ
VEERRTEAISSCNCKFQWCCTVRCDQCRQVVNKYYCXKLPGSAWSRGKASA
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggggacttgtttatgctcagggtagctgtgggcatatgctatgccaccttcagtgcc
tcagcctggtcagtgaacaatttcctgataacaggtcccaaggcctatctgacctacacg
accagcgtggccctgggtgcccagagtggcattgaggagtgtaagttccaatttgcttgg
gaacgctggaactgcccggaaaatgctctccagctttccactcacaacaggctgagaagt
gccaccagggagacctccttcattcatgccatcagctctgctggggtcatgtacaccatc
accaagaactgtagcatgggcgactttgaaaactgtggctgtgatgagtcgaaaaatggt
aaaacaggaggtcatggctggatctggggaggctgcagtgacaatgtggaatttggggaa
aggatctccaaactctttgtggacagcctggaaaagggaaaggatgccagagccctgatg
aatcttcacaacaacagggcaggcaggctggccgtgagagccatcatgaagaggacctgc
aaatgtcatggcatctctgggagctgcagcatccagacatgctggctgcagctggctgac
ttccgggagatgggcgactacctgaaggccaagtatgaccgggccctgaaaattgagatg
gataagcggcagttgagggctggcaacagtgctgagggccgctgggcacccactgaggcc
ttccttcctagtgccgaggctgagctgatctttttagaggaatcgccagattactgtacc
cgcaattccagcctgggcatccatggcacggaaggtcgggagtgtctgcagaacagccac
aacacatccaggtgggagcagcgcagctgcgggcgcttgtgcaccgagtgtggcctgcag
gtggaagagagaagaactgaggctatcagcagctgtaactgcaaattccagtggtgctgt
acagtccggtgtgaccagtgtaggcaggtggtgaacaagtactactgcntcaagctccca
ggcagtgcctggtcccgaggcaaggccagtgcctga

KEGG   Ailuropoda melanoleuca (giant panda): 100484068
Entry
100484068         CDS       T01329                                 

Gene name
WNT5A
Definition
(RefSeq) protein Wnt-5a isoform X1
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100484068 (WNT5A)
   04390 Hippo signaling pathway
    100484068 (WNT5A)
   04150 mTOR signaling pathway
    100484068 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100484068 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100484068 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    100484068 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100484068 (WNT5A)
   05205 Proteoglycans in cancer
    100484068 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100484068 (WNT5A)
   05226 Gastric cancer
    100484068 (WNT5A)
   05217 Basal cell carcinoma
    100484068 (WNT5A)
   05224 Breast cancer
    100484068 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100484068 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    100484068 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100484068 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100484068 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100484068 (WNT5A)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100484068 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100484068
NCBI-ProteinID: XP_034514376
LinkDB
Position
4
AA seq 380 aa
MKKSIGILSPGVALGTAGSAMSSKFFLMALAIFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagaagtcgattggaatattaagcccaggagttgctttggggacggctggaagtgca
atgtcttccaagttcttcctaatggctttggccatatttttctccttcgcccaggttgta
atagaagccaattcttggtggtcgctaggtatgaataaccctgttcagatgtcagaagta
tatatcataggagcacagcctctctgcagccagctggcaggactttctcaaggacagaag
aaactgtgccacttgtaccaagaccacatgcagtacattggagaaggcgcgaagacgggc
atcaaagagtgccagtaccagttccggcaccggcggtggaactgcagcaccgtggataac
acctccgttttcggcagggtcatgcagataggcagccgcgagacggccttcacgtacgcg
gtgagcgccgcgggggtggtgaacgccatgagccgcgcgtgccgcgagggcgagctgtcc
acctgcggctgcagccgcgccgcgcgccccaaggacctgccgcgggactggctgtggggc
ggctgcggcgacaacatcgactacggctaccgcttcgccaaggagttcgtggacgcgcgc
gagcgggagcgcatccacgccaagggctcgtacgagagcgcgcgcatcctcatgaacttg
cacaacaacgaggccggccgcaggacggtgtacaacctggccgacgtggcctgcaagtgc
cacggggtgtcgggctcctgtagcctcaagacgtgctggctgcagctggccgacttccgc
aaggtgggcgacgcgctgaaggagaagtacgacagcgcagcggccatgcggctcaacagc
cggggcaagctggtgcaggtcaacagccgcttcaactcgcccaccacgcaggacctggtc
tacatcgacccgagccccgactactgcgtgcgcaacgagagcacgggctcgctgggcacg
cagggccgcctgtgcaacaagacgtcggagggcatggacggctgcgagctcatgtgctgc
ggccgcggctacgaccagttcaagaccgtgcagacggagcgctgccactgcaagttccac
tggtgctgttacgtcaagtgcaagaagtgcacggagatcgtggaccagttcgtgtgcaaa
tag

DBGET integrated database retrieval system