KEGG   Ailuropoda melanoleuca (giant panda): 100464396
Entry
100464396         CDS       T01329                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04110  Cell cycle
aml04151  PI3K-Akt signaling pathway
aml04218  Cellular senescence
aml04310  Wnt signaling pathway
aml04350  TGF-beta signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04630  JAK-STAT signaling pathway
aml04919  Thyroid hormone signaling pathway
aml05132  Salmonella infection
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05213  Endometrial cancer
aml05216  Thyroid cancer
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05222  Small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100464396 (MYC)
   04012 ErbB signaling pathway
    100464396 (MYC)
   04310 Wnt signaling pathway
    100464396 (MYC)
   04350 TGF-beta signaling pathway
    100464396 (MYC)
   04390 Hippo signaling pathway
    100464396 (MYC)
   04630 JAK-STAT signaling pathway
    100464396 (MYC)
   04151 PI3K-Akt signaling pathway
    100464396 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100464396 (MYC)
   04218 Cellular senescence
    100464396 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100464396 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100464396 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100464396 (MYC)
   05202 Transcriptional misregulation in cancer
    100464396 (MYC)
   05206 MicroRNAs in cancer
    100464396 (MYC)
   05205 Proteoglycans in cancer
    100464396 (MYC)
   05230 Central carbon metabolism in cancer
    100464396 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100464396 (MYC)
   05225 Hepatocellular carcinoma
    100464396 (MYC)
   05226 Gastric cancer
    100464396 (MYC)
   05216 Thyroid cancer
    100464396 (MYC)
   05221 Acute myeloid leukemia
    100464396 (MYC)
   05220 Chronic myeloid leukemia
    100464396 (MYC)
   05219 Bladder cancer
    100464396 (MYC)
   05213 Endometrial cancer
    100464396 (MYC)
   05224 Breast cancer
    100464396 (MYC)
   05222 Small cell lung cancer
    100464396 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100464396 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100464396 (MYC)
   05161 Hepatitis B
    100464396 (MYC)
   05160 Hepatitis C
    100464396 (MYC)
   05163 Human cytomegalovirus infection
    100464396 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100464396 (MYC)
   05169 Epstein-Barr virus infection
    100464396 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100464396 (MYC)
   03019 Messenger RNA biogenesis [BR:aml03019]
    100464396 (MYC)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    100464396 (MYC)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100464396 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 100464396
NCBI-ProteinID: XP_002915028
LinkDB
Position
9
AA seq 439 aa
MPLNVSFANRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVASFSPRGDDDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSSSPSPARGPGGCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSSAESSPRASPEPLAL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSSGSHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQTEEQKLISEKDLL
RKRREQLKHKLEQLRNSGA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctgaacgtcagcttcgccaacaggaactatgacctcgactacgactcggtacag
ccttatttctactgcgacgaggaggagaacttctaccagcagcagcagcagagcgagctg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccg
ctgtccccgagccgccgctcggggctctgctcgccctcctacgttgcagtcgcgtccttc
tcccccaggggggacgacgacggcggcggcggcagcttttccacggccgaccagttggag
atggtgaccgagctgctgggaggggacatggtgaaccagagcttcatctgcgacccggac
gacgagaccttcatcaaaaacatcatcatccaggactgcatgtggagcggcttctcggcc
gccgccaagctcgtctctgagaagctggcctcctaccaggctgcgcgcaaagacagcagc
agcccgagccccgcccgcgggcccggcggctgctccacctccagcctgtacctgcaggac
ctgagcgccgccgcctccgagtgcatcgacccgtccgtggtcttcccctacccgctcaac
gacagcagctcgcccaagccctgcgcctccccggactccaccgccttctccccgtcctcg
gactctctgctctcctcggccgagtcctccccgcgggccagccccgagcccctggcgctc
cacgaggagacaccgcccaccaccagcagcgactctgaggaagaacaagaggacgaagaa
gaaattgatgttgtttctgtggaaaaaaggcagccccctgccaaaaggtcagaatcgggg
tcaccgtcgtcgggaagccacagcaaaccacctcacagcccgctggtccttaaaagatgc
catgtgtccacccatcagcacaattacgcagcgcccccctccaccagaaaggactatccg
gccgccaagagggctaagttggacagtggcagagtcctgaaacaaatcagcaacaaccgt
aaatgtgccagccccaggtcttcggacacagaggagaacgacaagaggcggacacacaac
gtcttagaacgccagaggagaaacgagctgaaacggagcttttttgccctgcgtgaccag
atcccggagttggaaaacaatgaaaaggcccccaaggttgtcatccttaaaaaagccacc
gcgtacatcctgtccgtccaaacagaggagcagaagctcatctcagaaaaggacttgttg
cggaagcggcgagaacagttgaaacacaaacttgaacagctaaggaactctggtgcctaa

DBGET integrated database retrieval system