KEGG   Ailuropoda melanoleuca (giant panda): 100464435Help
Entry
100464435         CDS       T01329                                 

Gene name
DOT1L
Definition
(RefSeq) DOT1 like histone lysine methyltransferase
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00310  Lysine degradation
aml05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100464435 (DOT1L)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    100464435 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100464435 (DOT1L)
Enzymes [BR:aml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100464435 (DOT1L)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100464435 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 HALZ
Motif
Other DBs
NCBI-GeneID: 100464435
NCBI-ProteinID: XP_019662170
Ensembl: ENSAMEG00000005436
LinkDB All DBs
Position
Un
AA seq 1530 aa AA seqDB search
MENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSNGLLRHILQQV
YNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVA
AATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIAN
TSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVV
ELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRESKSTTT
TPTKVPESKAAVPADTPMDSGAEEEKAGATAIKKPSPSKARKKKLNKKGRKMAGRKRGRP
KKMSTANPERKPKKSQTALDLLHAQAAAQTAAPSPQDAYKSPHSPFYQLPPSVQRHPPDQ
LLLAPTPPALQKLLESFKIQYLQFLAYTKTAQYKASLQQLLDQEKEKNARLLGAAQQLFG
HCQAQKEEIKRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQTEQLQKDNRELRS
QSLQLLKARCEELKLDWSTLSLENLLKEKQALRTQISEKQRHCLELQISIVELEKSQRQQ
ELLQLKSCVPPDDALAAHLRGKGSLGRELEADAGRLHLDLDCSKFSLPHFSSASPELSIN
GHAASYEVCSALSRPSSKQNTPQYLASPLDQEVVPCTPSHSSRSRLEKMSGLALPDYTRL
SPAKLVLRRHLSQDHAASGKTAAGELHPRAEHAKENGLPYQSPGIANGIKLSPQDPRPSS
PVALQMTGERGGEKGLKERAYASSGEAITSLPVSIPLSTVQPSKLPVSIPLASVVLPSRA
EKVRSTPSPVPQTRESSSALEKQMGTNAHSAGSKSLAPAPAGFYTGSVAVSGALAGSPAP
LAPGAESSAFDEVSGSGSLFASVGSCSSTPQHPPLLPQSRGSGTASPAHPLCASPRLSSA
TQGPLPEASKGDFPSETGFSDPEGEAKRRIVFTISAGGSGAKQSPPSKPSPLPTGARGDS
GQGHGSDSRKRGRRKRAAAGTPSLSSSVSPKRRALPSVAGLFTQSSGSPLNLNSMVSNIN
QPLEITAISSPESLKSSPVPYQDNDQPPVLKKEKPLSQTNGAHYSPLTSDEEQGSEDEPG
SARIERKIATISLESKSPPKTLESGGSLAGRKPTPAGEPANSSKWKSTFSPISDLGLAKC
ADSPLQAGSALSQNSLFTFRPPLEEPGLADAKLAAHPRKSFPGALSGAGGLSPSSNPPNG
FAFSGGLAADLSLHSFSDGASLSHKVPEAASLGAPLSFPAPRGKEGSATEPGAFVNKRQL
DGLGGPKGREAGELGLPACGPPDKVSLTHSKPGKGRDREPDLKNGHNLFISAATVPPGGL
LSGPGLATVASSTVSAAPSAQTHRPFLGTFAPGPQFALGPMSLQANLGSSVLQSLFSSVP
AAAGLVHVSSAATRLTNSHAMGSFSSGVAGGAVGGVFNHAVPSASAHPFGASFGSGAACR
SATLSLTPLQAVASAPASSFQAPPPPPAPG
NT seq 4593 nt NT seq  +upstreamnt  +downstreamnt
atggagaattatgttctcatcgactacgacaccaaaagctttgaaagcatgcagaggctc
tgtgacaaatacaaccgtgccatcgacagcatccaccagctgtggaaggggaccacgcag
cccatgaaactgaacacgcggccgtccaacgggctcctgcggcacatcctgcagcaggtc
tacaaccactcggtgacggaccctgagaagctcaacaactacgagcccttctccccggag
gtgtacggagagacctcctttgacttggtcgcgcagatgatcgatgagatcaagatgacc
gaggatgacctgtttgtggacctgggcagtggagtgggccaggtcgtgctgcaggtcgcc
gcggcaaccaactgcaagcatcactatggcgtggagaaagccgacatcccagccaagtac
gcggagaccatggaccgagagttcaggaagtggatgaaatggtatggaaaaaagcatgca
gaatacacactggaaagaggcgacttcctctcggaagagtggagagagcggattgccaac
acaagtgttatatttgtgaataattttgcctttggtcctgaggtggatcaccagctgaag
gagcggtttgcgaacatgaaggaaggtggcagaatcgtttcctcgaagccctttgcgcct
ctgaacttcagaataaacagcagaaacttgagtgacatcggcaccatcatgcgcgttgtg
gagctctcgcccctgaaaggctcggtgtcctggacggggaagccggtctcttactacctg
cacaccatcgaccgcaccatacttgaaaactatttttctagtctgaaaaacccaaaactc
agggaggaacaggaggcagctcggcgcaggcagcagcgagagagcaagagcaccacgacc
actcccaccaaggtgcccgaaagcaaggctgccgtgcccgcggacaccccgatggattcc
ggggctgaggaagaaaaggctggggcgactgccatcaaaaagccgtccccctccaaagcc
cggaagaagaagctgaacaagaaggggcggaagatggccggccggaagcgcgggcgtccc
aagaagatgagcactgcgaaccccgagcgtaagcccaagaagagccaaactgcactggac
ctcctgcacgcccaggccgcggcgcagacggcagcgccctcgccgcaggatgcgtacaag
tcacctcatagcccgttttaccagctacctcccagtgtgcagcggcacccccccgaccag
ctgctgctggcacccaccccgcccgcactgcagaagctgctagaatccttcaagattcag
tacttgcagttcttggcatataccaagaccgcccagtacaaggccagcctgcagcagctg
ctggaccaggagaaggagaagaacgcgcggttgctaggcgctgcccagcagctgtttggc
cactgccaggcccagaaagaggagatcaagaggcttttccagcagaaactggatgagctg
ggagtgaaggcgctgacctacaacgacctgatccaggcgcagaaggagatctcggctcac
aaccagcagctgagggagcagacggagcagctgcagaaggacaacagggagctgaggagc
cagagcctgcagctgctcaaggctcggtgtgaggagctgaagctggactggtccacgctg
tccctggagaacctgctgaaggagaagcaggccctgcggacccagatctccgagaagcag
cggcactgcctggagctgcagataagcatcgtggagctggagaagagccagcggcagcag
gagctcctgcagctcaagtcctgcgtgccgccggacgatgccctggcggcacacctgcga
gggaaaggctccctgggccgggagctggaggccgacgccggccggctgcacctcgacctg
gactgctccaagttctctctgccccacttcagcagcgcgagcccagaactctccataaac
ggccatgcggccagctacgaggtctgcagtgcgctgagccggccctcgtccaagcagaac
accccccagtacctggcctcccccctggaccaggaagtcgtaccctgcacgcccagccac
agcagccgctcgaggctcgagaagatgtcgggcctggccttgcccgactacacccggctc
tccccagccaagctggtgctgaggcgtcacctgagccaggaccacgcggccagtggcaag
actgcggctggcgagctgcacccgcgagctgagcacgccaaggagaacggccttccgtac
cagagccctggcatcgcaaatggcatcaagctgagccctcaggaccctcgaccttcatcc
cccgtggccttacagatgacaggggagaggggcggcgagaagggtttgaaggagcgtgcc
tacgccagcagcggggaggccatcaccagcctgcccgtcagcatcccgctcagcaccgtg
cagccgagcaagctgcccgtcagcatccctctggccagtgtggtgctgcccagccgcgcc
gagaaagtgagaagcacccccagccctgtgccgcagacccgagagtcctcgtccgcactt
gaaaagcagatgggcacgaatgcccacagtgctggaagcaaaagcctcgccccagctcct
gcaggcttctacactggctcggtggccgtcagtggggccctggcaggcagcccggccccc
ctcgctcctggagccgagtccagcgcctttgacgaggtctccggctcaggaagcctgttc
gccagcgtggggtcctgcagctctaccccacagcacccgcccctgctgccgcagtcccgc
ggctctggcacggcctcacctgcccatccactctgcgccagcccccggctcagcagtgcc
acccagggcccgctccccgaggccagcaaaggggactttccgtccgagaccggcttctcc
gaccccgagggcgaagccaagaggagaatcgtctttaccatctcagctggcggcagtggt
gccaagcagtcacctcccagcaaacccagccctctgcccacgggtgcccgcggggacagc
ggccagggccacgggtcggacagtcgcaagcggggcaggaggaagcgggcggcggccggg
acccccagcctgagctccagcgtgtcgcccaagcgtcgggccctgccgtccgttgccggc
ctcttcacgcagtcgtcagggtccccactgaacctcaactcgatggtcagcaacattaat
cagcctttggaaatcacggccatctcgtcccccgagagcctgaagagctcccctgtcccc
taccaggacaacgaccagccgcccgttctcaagaaggagaagcccttgagccagaccaac
ggggcccactactccccactgacctcagacgaggagcaaggctccgaggacgagccgggc
agcgccagaatcgagagaaaaattgcaacaatctccttagaaagcaaatctcctccgaaa
accttggaaagtggtggtagcctggccggcaggaagccgacccctgccggtgagcccgcc
aacagcagcaagtggaaatccaccttctcgcccatctccgacctcggcctggccaagtgt
gccgacagcccgctgcaggccggctctgccctgagccagaactccctgttcactttccgg
ccccccctagaggagcccggcttggccgatgccaagctggctgcccaccccaggaaaagc
tttcccggtgcgctgtcgggggccggtgggctgagccccagcagcaaccctcccaatggc
ttcgccttcagcgggggcctggccgccgacctcagtttacacagcttcagcgatggtgct
tctctctcccacaaggttcccgaggccgccagcctgggtgcccccctgagcttccccgcc
ccgcggggcaaggagggcagtgccacagagcccggcgcctttgtgaacaagaggcagctg
gacggactgggaggcccaaagggcagggaggcaggcgagctgggcctgccggcgtgcggg
cccccagacaaggtctcgctgacgcacagcaagccaggcaagggccgggaccgtgagccc
gacttgaagaacggccacaacctcttcatttctgccgccactgtgcctcccgggggcctc
ctcagtggcccgggcctcgccacggtggcgtcctcgacagtcagcgcggccccctctgcc
cagactcaccgccccttcctgggcacctttgcccctggcccgcagttcgccctgggtccc
atgtccctgcaggccaatctgggctcgtccgtgctacagtccttgttcagctccgtgcca
gccgccgccggcctggtgcacgtctcgtccgccgcgaccagactgaccaactcgcacgcc
atgggcagcttctcctccggggtggcaggcggcgctgttggaggtgtctttaaccacgcg
gtgccttccgcctccgctcatccgtttggagccagtttcggcagcggggctgcgtgtcgc
agcgccacgctgagcttaaccccgctgcaggcggtggccagcgcccccgcgtcttccttt
caggccccgcccccgccccctgctcccggctaa

DBGET integrated database retrieval system