KEGG   Ailuropoda melanoleuca (giant panda): 100464546
Entry
100464546         CDS       T01329                                 

Gene name
BUB1B
Definition
(RefSeq) mitotic checkpoint serine/threonine-protein kinase BUB1 beta isoform X3
  KO
K06637  mitotic checkpoint serine/threonine-protein kinase BUB1 beta [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100464546 (BUB1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100464546 (BUB1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100464546 (BUB1B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100464546 (BUB1B)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100464546 (BUB1B)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: Other
  BUB family
   100464546 (BUB1B)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     100464546 (BUB1B)
SSDB
Motif
Pfam: Mad3_BUB1_I Pkinase Mad3_BUB1_II Mad3_BUB1_I_2
Other DBs
NCBI-GeneID: 100464546
NCBI-ProteinID: XP_002913273
Ensembl: ENSAMEG00000017203
LinkDB
Position
5
AA seq 1062 aa
MAAMKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQQESASNATLQQQK
RAFESEIRFYTGNDPLDVWDRYINWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYNDP
RFLSLWLKLGHLCNEPLDMYSYLHSQGIGVSLAQFYISWAEEYEARENFKKADKIFQEGI
QQKAEPLDRLQSQHRQFQARVSRQTVLALEKEEEEEVFGSSEPQRSTLAELKSKGKKTAR
APISRVGGALKAPNQNRGLQNPVPQQMQSNSRITVFDENADEASRAELSKPTVQPWIAPP
VSRAKENELQAGPWNTGRPLEYRPRGGIASVTTVPSLLPSFTPYVEETAQQPVMTPCKIE
PSINHILSTRKPGKEEGDPLQRVQSHQQESQEKKEKMMYCKEKIYAGVGEFSFEEIRAEV
FRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQRERTGDQQEEKMTTKETAE
LQIALESQEIPGMALSNSVCPVNSCARETSLAENIWQEPHSKGPSIPFSIFDEFLLSEKK
NTSRPADPPRVLSQRRPFAILKTSESINSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVT
ICPNPEDTCDFARAARFVSTPFHEIVSLKDLPSDPERLLQEEDLDMKLSEDQQTACGTIY
NPTLSIKKLSPIIEDSREATHSSGFSGSSASVTSSSSIKCLQIPEKLELTNETADNPTQS
PWCPQYRRQLLKSLMELRASAEFFIEDRPMPKLEIEKEIELGNEDYCIKQEYLICEDYKL
FWVTPGNSAELTIIKVSSQPVPWDFYINLKLKERLNEEYDHLCSCYQYQDGCIVWHQYIN
CFTLQDLLQHSELITHEIIVLVIYNLLTIVEKLHRAEIVHGDLSPRSLILRNRIHDPYDY
NKNDQALKIVDFSYSVDLRVQPDVFILSGFRTVQILEGQKILANCSSPYQVDLFGIADLA
HLLLFKEHLQVFWDGSLWKLSQNISELKDGELWNKFFVRILNASDESTVSVLRELGAAMS
GVFDTTFQNHLNKALWKVGQLISPGALLFQQDRQSHLSQIPA
NT seq 3189 nt   +upstreamnt  +downstreamnt
atggcggcgatgaagaaggaagggggtgctctgagtgaagccatgtccttggagggagat
gagtgggagctgagtaaagaaaatgtccaaccactaaggcaggggaggatcatgtccaca
cttcagggagcattggctcagcaagaatctgcctctaacgctactcttcagcaacagaaa
cgggcatttgaatctgaaattcgattttacactggaaatgaccctctggatgtttgggat
aggtatattaactggacagagcagaactatcctcagggggggaaagagagtaatatgtcg
acattattagaaagagctgttgaagcactacaaggagaaaaacgatactataatgatccc
cgatttcttagtctctggcttaaattggggcatttatgcaatgaacctttggatatgtac
agttatttacacagccaagggatcggtgtttcacttgctcaattctatatctcatgggct
gaagaatatgaagctagagaaaactttaagaaagcagataagatatttcaggaggggatt
caacagaaggccgaaccactggaccgactgcagtcacagcaccgacaattccaagctcgg
gtgtctcggcaaactgtgttggcacttgagaaagaagaggaggaggaagtttttggatct
tctgaaccacaacgaagcacactggctgaactaaaaagcaaagggaagaagacagcaaga
gctccaatcagccgtgtaggaggtgctcttaaggctccaaaccagaacagaggactccaa
aatccagttcctcaacagatgcaaagtaattccagaattactgtttttgatgaaaatgct
gatgaggcttctagagcagagttgtctaagcctacagttcagccatggatagcaccccct
gtgtccagggccaaagagaacgagctgcaggcaggcccttggaacacaggcaggcctttg
gaatacaggcctcgtggtggtatagcttctgtgaccactgtaccctctctgcttcccagt
tttactccatatgttgaagaaactgcacaacagccagttatgacaccatgtaaaattgaa
cctagtataaaccacattctaagcacaagaaagcctggaaaggaagaaggagatcccctg
caaagagttcaaagccatcagcaagagtcccaggagaagaaagagaagatgatgtattgt
aaggagaagatttatgcaggggttggggagttctcctttgaagagatccgggctgaagtt
ttccggaagaaattaaaagagcaaagagaagctgagctactgaccagtgcagagaaaaga
gcagaaatgcagaaacagattgaagagatggagaagaagctcaaagaaattcaaactact
cagcgagaaagaacgggtgatcagcaagaagagaagatgactacaaaggagacagctgaa
ctgcaaattgctttggagtctcaggaaataccaggaatggctctatccaattctgtttgt
ccagtaaactcttgtgccagggagacttcacttgcagaaaacatttggcaagaacctcat
tctaaaggtcccagtatacctttctccatttttgatgagtttcttctttcagaaaaaaaa
aataccagtcgtcctgccgatcccccacgggttttatcccaacgaagaccctttgcaatt
ctcaaaacttcagaaagcatcaactcaaatgaggatgtgtctccagatgtttgtgatgaa
tttacaggaattgagcccttgagtgaggatgctattatcacaggtttcaggaatgtaact
atctgtcctaacccagaagacacttgtgacttcgccagagcagctcgctttgtatccacg
ccttttcatgagatagtgtccttgaaggatctcccttctgatcctgagaggctgctgcag
gaggaggatctagacatgaagctctctgaggaccagcagactgcttgtggcaccatctac
aacccgactctcagcatcaagaagctcagcccaattatcgaagacagccgtgaagccaca
cactcctctgggttctctgggtcttctgcctcagttacaagttcctcctccatcaaatgt
cttcagattcctgagaaactggagcttactaatgagactgcagacaaccctactcagtca
ccctggtgtccacagtatcgcagacaactactaaaatctctgatggagctgagggcctct
gcagagttttttatagaagatagaccgatgcctaagttggaaatagaaaaggagattgaa
ctgggtaatgaggattattgcataaaacaagaatacctaatatgtgaagattacaagtta
ttctgggtgacaccaggaaactctgcagaattaaccataataaaggtatcgtctcaacct
gtcccatgggacttttatatcaacctcaagttaaaggaacgtttaaatgaggagtatgac
catttgtgcagctgttaccagtaccaagacggttgtattgtttggcaccaatatataaac
tgcttcacccttcaggatcttcttcaacacagtgaacttattacccatgaaataatagtg
ttggttatttataaccttttgacaatagtggagaaattacacagagcagaaatagtccat
ggtgacttgagtccaaggagtctgattcttagaaacagaatccacgatccctatgattat
aataagaacgatcaagctttgaagatagtggacttttcctacagtgtcgaccttagggtg
cagcctgatgtttttatcctcagcggctttcggactgtacaaatcctggaaggacaaaag
atcctggctaactgttcttctccctaccaggtagatctgtttggtatagcagatttagca
catttactgttgttcaaggaacacctacaggtcttctgggatgggtccctctggaaactt
agccaaaatatttctgagctaaaagatggtgaactgtggaataaattctttgtacggatt
ctgaatgccagtgatgagtccacagtgtctgttttgagggaacttggagcagcaatgagt
ggggtgtttgacaccacctttcaaaatcacctgaacaaagctttgtggaaggtagggcag
ttaatcagtcctggggctttgctctttcaacaggataggcaatcacatctctcacagatt
cctgcctaa

DBGET integrated database retrieval system