KEGG   Ailuropoda melanoleuca (giant panda): 100464548
Entry
100464548         CDS       T01329                                 

Gene name
DDX3X
Definition
(RefSeq) ATP-dependent RNA helicase DDX3X isoform X1
  KO
K11594  ATP-dependent RNA helicase DDX3X [EC:3.6.4.13]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04622  RIG-I-like receptor signaling pathway
aml05161  Hepatitis B
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100464548 (DDX3X)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100464548 (DDX3X)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100464548 (DDX3X)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:aml03019]
    100464548 (DDX3X)
   03041 Spliceosome [BR:aml03041]
    100464548 (DDX3X)
   03036 Chromosome and associated proteins [BR:aml03036]
    100464548 (DDX3X)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100464548 (DDX3X)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100464548 (DDX3X)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100464548 (DDX3X)
Spliceosome [BR:aml03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    100464548 (DDX3X)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    100464548 (DDX3X)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII UTP25
Other DBs
NCBI-GeneID: 100464548
NCBI-ProteinID: XP_011228930
Ensembl: ENSAMEG00000006801
LinkDB
Position
X
AA seq 662 aa
MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGW
SSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFE
RGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIE
SFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILS
QIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVV
YGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQ
IRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVV
WVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDR
EEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGL
ATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGAR
DYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWW
GN
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgagtcatgtggcggtggaaaatgcgctcgggctggaccagcagtttgctggactagac
ctgaactcctcagataatcagagtggaggaagtacagcaagcaaggggcgctatattcct
cctcacttaaggaacagagaagctactaaaggattctacgataaagacagttcagggtgg
agttctagtaaagataaggatgcatacagcagttttggatctcgtagtgattcaagaggg
aagtctagtttctttagtgatcgaggaagtggatcaaggggaaggtttgatgatcgtgga
cggagtgactacgatggcattggcagccgtggtgacagaagtggttttggcaaatttgaa
cgtggtggaaatagtcgctggtgtgacaaatcagatgaggatgattggtcaaaaccactc
ccaccaagtgaacgcttggaacaggaactcttctctggaggaaacactgggattaacttt
gagaaatatgacgacattccagttgaggcaacaggcaacaactgtcctccgcatattgaa
agtttcagtgacgttgagatgggagaaattattatgggcaatattgagcttactcgttac
actcgcccaactccagtgcaaaagcatgctattcctattatcaaagagaaaagagacttg
atggcttgtgctcaaacagggtctggaaaaactgcagcatttctcttacccatcttgagt
cagatttattcagatggtccaggcgaggctttgagggccatgaaggaaaatggaaggtat
gggcgtcgcaagcagtacccaatctccttggtattagcaccaactagagaattggcagta
cagatctatgaggaagccaggaaattttcataccgatctagagttcgaccttgcgtggtt
tatggtggtgctgatatcggtcaacagatacgagacttagagcgtggctgccacttgtta
gtagctactccaggacgtctagtggatatgatggaaagaggaaagattggattagacttt
tgcaaatacttggtgttagatgaagccgatcggatgttggatatgggttttgaacctcag
atacgtagaatagttgaacaagatactatgccaccaaaaggtgtccgccacactatgatg
tttagtgctactttccctaaggaaatacagatgctggcccgtgattttttggatgagtat
atctttttagctgtaggaagagttggctctacctctgagaatattacacagaaagtagtt
tgggtggaagagtccgacaaacggtcatttttgcttgaccttctaaatgcaacaggcaag
gattcactgactttagtgtttgtggagaccaaaaagggtgcagattctctggaagatttc
ttgtaccatgaagggtatgcttgtaccagtatccatggagaccgatctcagagagataga
gaagaggcccttcaccagttccgctcaggaaaaagcccaattctagtggctacagcagta
gcagcaagaggactggatatttcaaatgtgaaacatgttatcaattttgacttgccaagt
gatatcgaagagtatgtacatcgcattggccgtacaggacgtgtagggaaccttggcctt
gccacctcattctttaatgagagaaatataaacattaccaaggatttgttggatcttctt
gttgaagctaaacaagaagtgccatcttggttagaaaacatggcttacgaacaccactac
aagggtagcagtcgtggacgatctaagagtagtagattcagtggaggatttggtgcccga
gactatcgacaaagcagcggtgccagcagttccagcttcagcagcagccgcgcaagcagc
agccgcagtggtggaggcggccacggcagcagcagagggtttggtggaggtggctatgga
ggcttttacaacagtgatggatatggaggaaattataactcccagggggttgactggtgg
ggtaactga

DBGET integrated database retrieval system