KEGG   Ailuropoda melanoleuca (giant panda): 100464611Help
Entry
100464611         CDS       T01329                                 

Definition
(RefSeq) uncharacterized LOC100464611
  KO
K11253  histone H3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05034  Alcoholism
aml05202  Transcriptional misregulation in cancer
aml05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:aml00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    100464611
  Immune diseases
   05322 Systemic lupus erythematosus
    100464611
  Substance dependence
   05034 Alcoholism
    100464611
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100464611
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100464611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF TFIID-31kDa PAF DUF2195
Motif
Other DBs
NCBI-GeneID: 100464611
NCBI-ProteinID: XP_002928587
LinkDB All DBs
Position
Un
AA seq 351 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERARDASPAMRSKMSLTNEFMMPMALDEMPVSGCTCFSTLYTYTEFT
ARNLKIRTNQEDVAFINKSRRKSTFSCKPCLQSLVMARTKQTARKSTGGKAPRKQLATKA
ARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRF
QSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcacgaagcagacggcgcgcaagtcgaccggcggcaaggccccgcgcaagcag
ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac
cgctaccggcccggcacggtggccctgcgcgagatccggcgctaccagaagtccaccgag
ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac
ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc
atgcccaaggatatccagctggcgcgccgcatccgcggggagagggcgcgcgacgcctcg
cccgcgatgcgctcgaagatgtcgttgacgaacgagttcatgatgcccatggccttggac
gagatgccggtgtcggggtgcacctgcttcagcaccttgtacacgtacaccgaattcacc
gcgcggaatttgaagattcggaccaatcaggaggacgttgcctttataaataagagtcgg
cgcaaaagcactttcagttgtaaaccgtgtttgcaatctctcgttatggctcgcacgaag
cagacggcgcgcaagtcgaccggcggcaaggccccgcgcaagcagctggccaccaaggcg
gcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcaccgctaccggcccggc
acggtggccctgcgcgagatccggcgctaccagaagtccaccgagctgctgatccgcaag
ctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaagaccgacctgcgcttc
cagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctacctggtggggctcttc
gaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatcatgcccaaggacatc
cagctggcgcgccgcatccgcggggagagggcgtaa

DBGET integrated database retrieval system