KEGG   Ailuropoda melanoleuca (giant panda): 100464632
Entry
100464632         CDS       T01329                                 

Gene name
MEF2C
Definition
(RefSeq) myocyte-specific enhancer factor 2C isoform X3
  KO
K04454  MADS-box transcription enhancer factor 2C
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04371  Apelin signaling pathway
aml04921  Oxytocin signaling pathway
aml04928  Parathyroid hormone synthesis, secretion and action
aml05202  Transcriptional misregulation in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100464632 (MEF2C)
   04371 Apelin signaling pathway
    100464632 (MEF2C)
   04022 cGMP-PKG signaling pathway
    100464632 (MEF2C)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100464632 (MEF2C)
   04928 Parathyroid hormone synthesis, secretion and action
    100464632 (MEF2C)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100464632 (MEF2C)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100464632 (MEF2C)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    100464632 (MEF2C)
SSDB
Motif
Pfam: SRF-TF HJURP_C
Other DBs
NCBI-GeneID: 100464632
NCBI-ProteinID: XP_011231031
Ensembl: ENSAMEG00000013271
LinkDB
Position
3
AA seq 465 aa
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKI
NEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRN
SMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKS
PPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINNSQSAQSLATPVVSVATPTLPGQGM
GGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPPSALSQLGA
CTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSPVDSLSSCS
SSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggggagaaaaaagattcagattacgaggattatggatgaacgtaacagacaggtgaca
tttacaaagaggaaatttgggttgatgaagaaggcgtacgagctgagtgtgctctgtgac
tgtgagatcgcgctgatcatcttcaacagcaccaacaagctgttccagtatgcgagcacc
gacatggacaaggtgttgctcaagtacacagagtacaacgagccgcatgagagccggaca
aactcagacatcgtggagacgttgagaaagaagggccttaatggctgtgacagcccagat
cccgatgcagacgattcagtaggtcacagccctgagtctgaggacaagtacaggaaaatt
aacgaagatattgatctaatgatcagcaggcaaagattgtgtgctgttccacctcccaac
ttcgaaatgccagtctccatcccagtgtccagccacaacagtttggtatacagcaacccc
gtcagctcactgggaaaccccaaccttttgccactggcccatccttctctgcagagaaac
agtatgtctcctggtgtaacacatcgacctccaagtgcaggtaacacaggtggtctgatg
ggtggagacctcacatccggtgcaggcaccagtgcagggaacggatatggcaatccccga
aactcaccaggtctgctggtctcacctggtaacttgaacaagaatatgcaagcaaaatct
cctccccccatgaatttagggatgaataaccgtaaaccagatctccgagttcttattcca
ccaggcagcaagaatacgatgccatcagtgaatcaaaggataaataactcccagtctgct
cagtcattggctaccccagtggtttccgtagcaactcctactttaccaggacaagggatg
ggaggatatccatcagccatttcaacaacatatggtaccgagtactctctgagtagtgca
gacctgtcatctctgtctgggttcaacactgccagcgctcttcatcttgggtcagtaact
ggctggcaacagcaacacctacataacatgccgccatccgccctcagtcagctgggagct
tgcactagcactcatttatctcagagttcaaatctctccctgccttctactcaaagcctc
aacatcaagtcagaacctgtttctcctcctagagaccgtaccaccaccccttcgagatac
ccacaacacacgcgccacgaggcggggagatctcctgttgacagcttgagcagctgtagc
agttcctacgacgggagcgaccgagaggatcaccggaatgaattccactcccccattgga
ctcaccagaccttcgccggacgaaagggaaagtccctcagtcaagcgcatgcgactctct
gaaggatgggcaacatga

DBGET integrated database retrieval system