KEGG   Ailuropoda melanoleuca (giant panda): 100464675
Entry
100464675         CDS       T01329                                 

Gene name
CHUK
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha isoform X1
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01523  Antifolate resistance
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04062  Chemokine signaling pathway
aml04064  NF-kappa B signaling pathway
aml04068  FoxO signaling pathway
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04380  Osteoclast differentiation
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04623  Cytosolic DNA-sensing pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04668  TNF signaling pathway
aml04920  Adipocytokine signaling pathway
aml05010  Alzheimer disease
aml05132  Salmonella infection
aml05135  Yersinia infection
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05212  Pancreatic cancer
aml05215  Prostate cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05222  Small cell lung cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100464675 (CHUK)
   04014 Ras signaling pathway
    100464675 (CHUK)
   04064 NF-kappa B signaling pathway
    100464675 (CHUK)
   04668 TNF signaling pathway
    100464675 (CHUK)
   04068 FoxO signaling pathway
    100464675 (CHUK)
   04151 PI3K-Akt signaling pathway
    100464675 (CHUK)
   04150 mTOR signaling pathway
    100464675 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100464675 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100464675 (CHUK)
   04621 NOD-like receptor signaling pathway
    100464675 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    100464675 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    100464675 (CHUK)
   04625 C-type lectin receptor signaling pathway
    100464675 (CHUK)
   04660 T cell receptor signaling pathway
    100464675 (CHUK)
   04658 Th1 and Th2 cell differentiation
    100464675 (CHUK)
   04659 Th17 cell differentiation
    100464675 (CHUK)
   04657 IL-17 signaling pathway
    100464675 (CHUK)
   04662 B cell receptor signaling pathway
    100464675 (CHUK)
   04062 Chemokine signaling pathway
    100464675 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100464675 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100464675 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100464675 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100464675 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100464675 (CHUK)
   05221 Acute myeloid leukemia
    100464675 (CHUK)
   05220 Chronic myeloid leukemia
    100464675 (CHUK)
   05215 Prostate cancer
    100464675 (CHUK)
   05222 Small cell lung cancer
    100464675 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100464675 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100464675 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100464675 (CHUK)
   05135 Yersinia infection
    100464675 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100464675 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    100464675 (CHUK)
   05161 Hepatitis B
    100464675 (CHUK)
   05160 Hepatitis C
    100464675 (CHUK)
   05171 Coronavirus disease - COVID-19
    100464675 (CHUK)
   05164 Influenza A
    100464675 (CHUK)
   05162 Measles
    100464675 (CHUK)
   05168 Herpes simplex virus 1 infection
    100464675 (CHUK)
   05163 Human cytomegalovirus infection
    100464675 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100464675 (CHUK)
   05169 Epstein-Barr virus infection
    100464675 (CHUK)
   05165 Human papillomavirus infection
    100464675 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100464675 (CHUK)
   05142 Chagas disease
    100464675 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100464675 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100464675 (CHUK)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100464675 (CHUK)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100464675 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 100464675
NCBI-ProteinID: XP_002924321
Ensembl: ENSAMEG00000006839
LinkDB
Position
6
AA seq 745 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDVKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKARDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIMHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVRDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEMALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVVSSLEGAVAPQASAWLPPTSTEREHPLSCVVTPQDGETIAQMIEENLNCLGHL
STIIREGNEEQGSRMMNLDWSWLTE
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ctgggcaccggcggctttgggaacgtctgcctgtaccagcatcgggaacttgatgtcaaa
atagcaattaagtcatgtcgcctagaactaagtaccaaaaacagagaacggtggtgccat
gaaatccagatcatgaagaagttgaaccacgccaatgttgtaaaggcccgtgatgtacct
gaggaattgaattttttaattaatgatgtgcctcttctagcaatggaatactgttctgga
ggagatctccggaagttactcaacaaaccagaaaattgctgtggacttaaagaaagccag
atactttctttactgagtgatatagggtctgggatccgatatttgcatgaaaacaaaatt
atacatcgtgatctaaaacctgaaaacatagttcttcaggatgttgggggaaagattatg
cataaaataattgatctgggatatgccaaagatgttgatcaaggaagtctgtgtacatct
tttgtgggaacactgcaatatctggccccagaactctttgagaataagccttacacagcc
actgttgattattggagctttgggaccatggtatttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgacaggagaagttcggtttagtagtcatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggcttcagttgatgctg
aattgggatcctcagcaaagaggaggacctgtagatcttactttgaagcagccaagatgt
tttgtattaatggatcacattctgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttttgttaccacctgatgaaagtcttcattcactacagtctcgt
attgagcgtgaaactggaataaatactggttctcaagagctgctttcagagacaggaatt
tctctggatcctcggaaaccagcctctcaatgtgttctagatggagtcagaggctgtgat
agctatatggtgtatttgtttgataaaagtaagactgtatatgaaggaccatttgcttcc
agaagtttatctgactgtgtaaattatattgtacgggacagcaaaatacagcttccaatt
atacagctgcgtaaagtatgggctgaagcagtacactatgtgtctgggctaaaagaagac
tacagcaggctctttcagggacaaagagcagcaatgttaagtcttcttcgatacaatgct
aacttgacaaaaatgaagaacactttgatctcagcatctcagcaactgaaagctaaattg
gagtttttccacaaaagcattcagcttgacttggaaagatacagtgagcagatgacttat
gggatatcctcagaaaaaatgttaaaagcatggaaggaaatggaagaaaaggctatccac
tatgctgaggtgggtgtcattggttacctggaggatcagatcatgtccctgcacactgaa
atcatggagctgcagaagagcccttatggaagacgtcagggagacttgatggaatctctg
gaacagcgtgccattgatctgtataagcagttaaagcacagaccttcagatcactcctac
agcgacagcacggaaatggtgaagatcattgtgcatactgttcaaagtcaggaccgggtt
ctcaaggagctgtttggtcatctgagcaagttactgggctgtaagcagaagattattgat
ctactgcccaaggtggaaatggccctcagtaacatcaaagaagctgacaatactgtcatg
tttatgcagggaaagagacagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccggtcccttgtagtatccagtctagaaggtgcagtagcccctcaggcatca
gcatggcttcccccaacttcaacagaacgtgaacatcctctgtcatgcgtggtaactcct
caagatggggagactatagcacaaatgatagaagaaaatttgaactgtcttggccattta
agcactattattcgtgaaggaaatgaggaacagggcagtagaatgatgaatcttgattgg
agttggttaacagaatga

KEGG   Ailuropoda melanoleuca (giant panda): 100470223
Entry
100470223         CDS       T01329                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01523  Antifolate resistance
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04062  Chemokine signaling pathway
aml04064  NF-kappa B signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04380  Osteoclast differentiation
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04623  Cytosolic DNA-sensing pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04668  TNF signaling pathway
aml04920  Adipocytokine signaling pathway
aml05132  Salmonella infection
aml05135  Yersinia infection
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05212  Pancreatic cancer
aml05215  Prostate cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05222  Small cell lung cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05340  Primary immunodeficiency
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100470223 (IKBKG)
   04014 Ras signaling pathway
    100470223 (IKBKG)
   04064 NF-kappa B signaling pathway
    100470223 (IKBKG)
   04668 TNF signaling pathway
    100470223 (IKBKG)
   04151 PI3K-Akt signaling pathway
    100470223 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100470223 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100470223 (IKBKG)
   04621 NOD-like receptor signaling pathway
    100470223 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    100470223 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    100470223 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    100470223 (IKBKG)
   04660 T cell receptor signaling pathway
    100470223 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    100470223 (IKBKG)
   04659 Th17 cell differentiation
    100470223 (IKBKG)
   04657 IL-17 signaling pathway
    100470223 (IKBKG)
   04662 B cell receptor signaling pathway
    100470223 (IKBKG)
   04062 Chemokine signaling pathway
    100470223 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100470223 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100470223 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100470223 (IKBKG)
   05203 Viral carcinogenesis
    100470223 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100470223 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100470223 (IKBKG)
   05221 Acute myeloid leukemia
    100470223 (IKBKG)
   05220 Chronic myeloid leukemia
    100470223 (IKBKG)
   05215 Prostate cancer
    100470223 (IKBKG)
   05222 Small cell lung cancer
    100470223 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    100470223 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100470223 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100470223 (IKBKG)
   05135 Yersinia infection
    100470223 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100470223 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    100470223 (IKBKG)
   05161 Hepatitis B
    100470223 (IKBKG)
   05160 Hepatitis C
    100470223 (IKBKG)
   05171 Coronavirus disease - COVID-19
    100470223 (IKBKG)
   05164 Influenza A
    100470223 (IKBKG)
   05162 Measles
    100470223 (IKBKG)
   05168 Herpes simplex virus 1 infection
    100470223 (IKBKG)
   05163 Human cytomegalovirus infection
    100470223 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100470223 (IKBKG)
   05169 Epstein-Barr virus infection
    100470223 (IKBKG)
   05165 Human papillomavirus infection
    100470223 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100470223 (IKBKG)
   05142 Chagas disease
    100470223 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100470223 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100470223 (IKBKG)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100470223 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 LLC1
Other DBs
NCBI-GeneID: 100470223
NCBI-ProteinID: XP_002929730
Ensembl: ENSAMEG00000000410
LinkDB
Position
X
AA seq 419 aa
MSRPPWKSQLCEMVQPSGGPAGDQDVLGEESSLGKPAMLHLPSEQGTPETFQRCLEENQE
LRDAIRQSNQMLRERCEELQRFQGSQRKEKEFLMQKFQEARKLVERLSLEKLDLRRQREQ
ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDSHIKSSVVSSERNRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKMVMETVPV
LKAQADIYKADFQAERQAREKLAEKKEFLQEQLEQLQREYSRLKASCQESARIEDLRKRH
VEVSQAPLPPTPAHPSFHLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggcccccctggaagagtcagctgtgtgagatggtgcagcccagtggcggcccg
gcaggggaccaggacgtgctgggtgaagagtcttctctggggaagccagctatgctccac
ctaccttctgagcagggcactcctgagaccttccagcgctgtctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgcttcgggagcgctgtgaggagctgcag
cgtttccaaggcagccagaggaaggagaaggagttcctcatgcagaaattccaagaagcc
aggaaactggtagaaagactgagcctggagaaactggacctgaggaggcagagggagcag
gccctgcaggaggtggaacatctgaagagatgccagcagcagatggctgaggacaaggcc
tccgtgaaagcccaggtgacatccttgctgggggagctccaagagagccagagtcgtttg
gaggctgccaccaaggagcggcaggctttggagggcagggcccgggctgccagcgagcag
gcccggcagctggagagcgagcgggaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagagccagagcgtggaggcggccctgcgcatggagcgccaggctgcc
tcggaggagaagcggaagctggcccagctgcaggtggcctatcaccagctcttccaggag
tatgacagccacatcaagagcagcgtggtgagcagtgagcgaaaccgaggaatgcagctg
gaggatctcaagcagcagctccagcaggccgaggaggccctggtggccaagcaggaagtg
attgacaagctgaaggaagaggctgagcagcacaagatggtgatggagactgtcccggtg
ctaaaggctcaggcggatatctacaaggcggacttccaggccgagaggcaggcccgggag
aagctggctgagaagaaggagttcctgcaggaacagctggagcagctgcagagggagtac
agcaggctgaaggccagctgtcaggagtcggccaggattgaagatctgaggaagcggcat
gtggaggtctcccaggcccccttaccccccaccccagctcacccttcctttcacctggcc
ctgcccagccagaggagaagcccgcccgaggagccacctgacttctgttgccccaagtgc
cagtatcaggctcctgatatggacaccctgcagatacatgtcatggagtgcatcgagtag

KEGG   Ailuropoda melanoleuca (giant panda): 100471679
Entry
100471679         CDS       T01329                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01523  Antifolate resistance
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04062  Chemokine signaling pathway
aml04064  NF-kappa B signaling pathway
aml04068  FoxO signaling pathway
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04380  Osteoclast differentiation
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04623  Cytosolic DNA-sensing pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04668  TNF signaling pathway
aml04722  Neurotrophin signaling pathway
aml04910  Insulin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04930  Type II diabetes mellitus
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml05010  Alzheimer disease
aml05132  Salmonella infection
aml05135  Yersinia infection
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05206  MicroRNAs in cancer
aml05212  Pancreatic cancer
aml05215  Prostate cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05222  Small cell lung cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100471679 (IKBKB)
   04014 Ras signaling pathway
    100471679 (IKBKB)
   04064 NF-kappa B signaling pathway
    100471679 (IKBKB)
   04668 TNF signaling pathway
    100471679 (IKBKB)
   04068 FoxO signaling pathway
    100471679 (IKBKB)
   04151 PI3K-Akt signaling pathway
    100471679 (IKBKB)
   04150 mTOR signaling pathway
    100471679 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100471679 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100471679 (IKBKB)
   04621 NOD-like receptor signaling pathway
    100471679 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    100471679 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    100471679 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    100471679 (IKBKB)
   04660 T cell receptor signaling pathway
    100471679 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    100471679 (IKBKB)
   04659 Th17 cell differentiation
    100471679 (IKBKB)
   04657 IL-17 signaling pathway
    100471679 (IKBKB)
   04662 B cell receptor signaling pathway
    100471679 (IKBKB)
   04062 Chemokine signaling pathway
    100471679 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100471679 (IKBKB)
   04920 Adipocytokine signaling pathway
    100471679 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100471679 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100471679 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100471679 (IKBKB)
   05206 MicroRNAs in cancer
    100471679 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100471679 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100471679 (IKBKB)
   05221 Acute myeloid leukemia
    100471679 (IKBKB)
   05220 Chronic myeloid leukemia
    100471679 (IKBKB)
   05215 Prostate cancer
    100471679 (IKBKB)
   05222 Small cell lung cancer
    100471679 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100471679 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100471679 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100471679 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    100471679 (IKBKB)
   04931 Insulin resistance
    100471679 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100471679 (IKBKB)
   05135 Yersinia infection
    100471679 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100471679 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    100471679 (IKBKB)
   05161 Hepatitis B
    100471679 (IKBKB)
   05160 Hepatitis C
    100471679 (IKBKB)
   05171 Coronavirus disease - COVID-19
    100471679 (IKBKB)
   05164 Influenza A
    100471679 (IKBKB)
   05162 Measles
    100471679 (IKBKB)
   05168 Herpes simplex virus 1 infection
    100471679 (IKBKB)
   05163 Human cytomegalovirus infection
    100471679 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100471679 (IKBKB)
   05169 Epstein-Barr virus infection
    100471679 (IKBKB)
   05165 Human papillomavirus infection
    100471679 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100471679 (IKBKB)
   05142 Chagas disease
    100471679 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100471679 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100471679 (IKBKB)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100471679 (IKBKB)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100471679 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo APH YrbL-PhoP_reg ubiquitin Med20 Glyco_hydro_65m
Other DBs
NCBI-GeneID: 100471679
NCBI-ProteinID: XP_019654266
Ensembl: ENSAMEG00000005170
UniProt: G1LFB0
LinkDB
Position
18
AA seq 755 aa
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AVLTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECVTGFRPFLPNWQPVQWHSKVRQKSE
MDIVVSEDLNGAVKFSSSLPYPNNLNSILAQRLEKWLQLMLMWHPRQRGTDPVYGPNGCF
KALDDILNLKLVHILNMVTGIIHTYPVTEDESLQSLQARIQQDTGIPEKDQELLQEAGLA
LIPDKPATQCISDGKLNEGRTLDMDLVFLFNNSKIAYETQISPRPQPESVSCILQEPKRN
LSFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEHAVELCGRENEVKHLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTDGDSQEMVRLLLQAIQG
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSHSGQLLSQPSAAPNSLPEAVKKSEELVAEAHTLCAQLE
NAMQDTIKEQDQSWRSLDWSWLQMEEEQNSLEQAS
NT seq 2268 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttctctgccaacccagacatgtggcgcctgggagatgaaagaacga
cttgggacagggggatttggaaacgtcatccgatggcacaatcaggagacaggggagcag
attgctatcaagcagtgccggcaggagctcagcccccggaaccgagagcgctggtgcctg
gagatccagatcatgaggaggctgaaccaccccaatgtggtggctgcccgggacgtcccc
gaggggatgcagaacttggctcccaatgacttgcccctgttggccatggagtactgccag
ggaggagatcttcgaaagtacctgaaccagtttgagaactgctgtggcctgcgggaagga
gccgtcctcaccctgctgagtgacattgcctctgcacttagataccttcatgaaaacaga
atcatccatcgggatctaaagccagaaaacatcgtcctgcagcaaggagagcaaagatta
atacacaaaattattgacctaggatatgccaaggaactggatcagggcagtctttgtact
tcctttgtggggaccctgcaatacctggccccagaactcctggagcagcagaagtacacg
gtgaccgtggactactggagcttcggcaccttggctttcgagtgcgtcacgggcttccga
ccttttctccctaactggcagcccgtgcagtggcattccaaagtccggcagaagagtgag
atggacattgtcgtcagtgaggacttgaatggagcggtgaagttttcaagctccttaccc
taccccaataatctgaacagcatcctggcacagcggctggagaagtggctgcagctgatg
ctgatgtggcacccacggcaaaggggcaccgatcctgtgtacgggcccaacggctgcttc
aaggccctggatgacatcttaaacctgaagctggttcatatcttgaacatggtcacaggc
atcattcacacctatccagtgacagaggacgagagtctgcagagcttgcaggccagaatc
cagcaagacacaggaatccctgagaaggaccaggagctgctgcaggaagctgggctggcg
ctgatccctgacaagcctgccactcagtgtatttcagatggcaagctgaatgagggccgc
acgctggacatggatctcgtctttctctttaacaacagtaaaattgcctatgagactcag
atctctccccggccccaacctgaaagtgtcagctgtatccttcaagagcccaagaggaac
ctgtctttcttccagctgaggaaggtgtggggccaggtctggcacagcatccaaaccctg
aaggaggactgtaaccggctgcaacagggacagcgagctgccatgatgaatctccttcgg
aataatagctgcctctccaagatgaagaattctatggcttccatgtctcagcagctcaaa
gccaaattggatttctttaaaaccagcatccagattgacctggagaagtacagtgagcaa
actgagtttggaatcacatcagataagctgctgctggcctggagggagatggagcacgct
gtggagctctgtgggcgggagaatgaagtgaagcacctggtggagcggatgatggcgctg
cagaccgacatcgtggacctgcagaggagcccgatggggcggaagcagggcggcacgctg
gacgacctagaagagcaggcaagggagctttacaggagacttcgggaaaaacccagagac
cagcgaacggatggcgacagtcaggagatggtccggctgctccttcaggccatccagggc
tttgagaagaaagtacgagtgatttatacacagctcagtaaaactgtggtttgcaagcag
aaggctctggaattattgcccaaggtggaagaggtggtgagtttaatgaacgaagatgag
aagactgttgtccggcttcaggagaagcggcagaaggagctctggaatctgctgaagatc
gcttgcagcaaagtccgtggccctgtcagcggaagcccagacagcatgaatgcttctcgc
ctcagtcactcgggtcagctgctgtctcagccttctgctgcccccaacagcctacccgag
gccgtcaagaaaagtgaagaactggtggctgaagcacatactctctgcgcccagctagaa
aacgcaatgcaagacaccatcaaagaacaggaccagagttggaggtctctagactggagc
tggttacagatggaagaagagcagaatagcctggaacaggcctcttga

DBGET integrated database retrieval system