KEGG   Ailuropoda melanoleuca (giant panda): 100464732
Entry
100464732         CDS       T01329                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa isoform X2
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03460  Fanconi anemia pathway
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05216  Thyroid cancer
aml05217  Basal cell carcinoma
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100464732 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100464732 (POLK)
   05202 Transcriptional misregulation in cancer
    100464732 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100464732 (POLK)
   05212 Pancreatic cancer
    100464732 (POLK)
   05225 Hepatocellular carcinoma
    100464732 (POLK)
   05226 Gastric cancer
    100464732 (POLK)
   05214 Glioma
    100464732 (POLK)
   05216 Thyroid cancer
    100464732 (POLK)
   05220 Chronic myeloid leukemia
    100464732 (POLK)
   05217 Basal cell carcinoma
    100464732 (POLK)
   05218 Melanoma
    100464732 (POLK)
   05213 Endometrial cancer
    100464732 (POLK)
   05224 Breast cancer
    100464732 (POLK)
   05222 Small cell lung cancer
    100464732 (POLK)
   05223 Non-small cell lung cancer
    100464732 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100464732 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aml03400]
    100464732 (POLK)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100464732 (POLK)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    100464732 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH
Other DBs
NCBI-GeneID: 100464732
NCBI-ProteinID: XP_002917258
Ensembl: ENSAMEG00000000744
LinkDB
Position
3
AA seq 869 aa
MDSTKEKNGNYKDDLLLRVGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRDLSNTIVHIDMDAFYAAVEMRDN
PELKDKPIAVGSMSMLSTSNYYARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSTE
VKEILADYDPNFMAMSLDEAYLNITQHLQERQNWPEDKRKYFIKTGNSLENEKPGKEAHK
LSEHERSTSPLLFDDSPPDLHPQGIPLQVNFEEQNNPQILQNSIVFGTSAEEVVKEIRFR
IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKNLPIRKVSGIGKV
TEKMLKALGIITCTELYQQRALLSLLFSETSWHHFLHISLGLGSTHLARDGERKSMSVER
TFSEVSKPEEQYSLCQELCSELAQDLQKEGLKGRTITIKLKNVNFEVKTRASTVSSVVST
AEEIFAIAKELLRTEIDAEFPHPLRLRLMGIRLSSFPNEEDKKQQRSIIGFLQAGNQTLS
AAGYILEKTDKDQFLKPLEISHKKSFFDKKRSERKWSHQDTFKCEAVDKQSLRTSHSFQV
LKKKMNENSETSENSNNSQIFTCPICFREQRSISLEAFNKHVDACLDGSLISENSSVFSC
SHASSTEISKKENVHPSFSLHEKQDYETHQKNSEISSVDCVELVETEDNPPEAESVGGLS
EKHSKEECPSLPSRSFNIAECCHNSSSTVSLEDTGSLSQQESSQPYLHEVITDQALVCPV
CNLEQKTSDLTLFNVHVDVCLNKGIIQELRKDKVNLANQPRESTQSTDNSGRVQKTATKP
KRPGSMTKYSASKKTKPNNPRHTLDVFFK
NT seq 2610 nt   +upstreamnt  +downstreamnt
atggatagcaccaaggagaagaatggcaattacaaagatgatcttctgcttagggtggga
cttaatgataataaagccggaatggaaggattagataaagagaagattaacaaaattata
atggaagccacaaaagggtccagattttatggaaatgaactcaagaaagaaaagcaagtc
aaccaacgaattgaaaatatgatgcaacaaaaagctcaaattaccagccaacagctaaga
aaagcacaattacaggttgacagatttgcaatggaattagaacagagccgggatctgagc
aacactattgtgcacattgacatggatgctttctatgcagctgtagaaatgagggacaat
ccagaattgaaggataaacccattgctgtaggatcaatgagtatgttgtctacttcaaat
tactacgcaaggaggtttggtgttcgcgcagccatgccaggatttattgctaaaagactc
tgcccacaacttattattgtgcccccaaactttgacaaataccgagctgtgagtacagag
gttaaggaaatacttgctgattatgatcccaattttatggccatgagtcttgatgaagcc
tacttgaatataacacagcacttacaggaaagacaaaattggcctgaggacaaaaggaag
tatttcatcaaaacagggaactctctagaaaatgagaaaccaggaaaagaagctcataag
ctgagtgagcatgaacgatccacgtctccactactttttgatgatagtcctcctgatttg
cacccccaaggaattcctttacaagtgaacttcgaagaacagaataatcctcaaatactc
caaaattcgattgtttttggaacatcagctgaagaagtggtaaaggaaattcgtttcaga
attgagcaaaaaacaacactgacagccagtgcaggcattgccccaaatacaatgttagca
aaagtatgcagtgataagaataaaccaaatggacaataccaaattctccccaacagacaa
gctgtgatggacttcatcaagaacttacccattagaaaggtttctggaataggaaaagtt
acggagaaaatgttaaaggcgcttggaattattacttgtacagaactctaccaacagagg
gcattgctttctcttcttttctctgaaacatcttggcatcatttccttcatatttccctg
ggtctaggttcaacacacctggcaagggatggagaaaggaaaagcatgagtgttgagagg
acattcagtgaggtaagtaagccagaagaacaatatagcttgtgccaggaactttgcagt
gaacttgctcaagatctgcagaaagaaggactaaagggtagaactattaccattaaactg
aagaatgtaaactttgaagtaaaaactcgtgcatctacggtttcatctgttgtttctact
gcagaagaaatatttgctattgctaaagaattgctaaggacagaaattgatgccgaattt
ccacatcccttgagattaagacttatgggtatacggttatccagctttcccaatgaagaa
gacaaaaaacaacaaaggagcattattggcttcttacaggctggaaaccaaactctgtca
gctgctgggtatatactagagaaaactgacaaagatcagtttctaaaacctctagaaata
tctcataagaagagtttctttgataaaaagcgatcagaaaggaaatggagccaccaagac
acatttaaatgtgaagctgtggataaacaaagtttgcggacatcacattcatttcaagtt
ttaaagaagaagatgaatgagaattcagaaacatcggagaattcaaataactctcagata
tttacctgtccaatttgctttagggagcaaagaagcatcagtctggaagcctttaataaa
catgtagatgcatgtcttgatggatctttgatcagtgaaaactccagtgtgttctcatgt
tcacatgcttcctctacagaaattagcaagaaagaaaatgtacatccttctttctcactc
catgagaagcaggattatgaaacccatcagaagaattcagaaatcagttcagtagattgt
gtagagctagtagagactgaagataatccgcctgaagcagaaagtgtaggtggtttaagt
gaaaagcacagcaaagaggaatgccctagtcttccaagcagatcatttaatattgcagaa
tgttgtcacaattcttcctctactgtttcattggaagatactgggtcattaagtcaacaa
gaatcctcccagccttatttacatgaagtgataacagaccaagctctagtttgtcctgtt
tgtaacctagaacaaaagacttcagatcttaccctgttcaatgtgcatgtggatgtatgc
ttaaataaaggcattatccaggaactgagaaaggataaagttaatctagctaaccaaccc
agagaaagcacccaaagtactgataactcaggcagagtgcagaagactgcaacaaaacca
aaaaggccgggatcgatgacaaagtactcagcatcaaagaaaacaaaaccgaacaatccc
agacatactcttgatgtattttttaaatga

DBGET integrated database retrieval system