KEGG   Ailuropoda melanoleuca (giant panda): 100464798
Entry
100464798         CDS       T01329                                 

Gene name
NFATC2
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2 isoform X4
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04022  cGMP-PKG signaling pathway
aml04218  Cellular senescence
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04625  C-type lectin receptor signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04921  Oxytocin signaling pathway
aml05135  Yersinia infection
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100464798 (NFATC2)
   04370 VEGF signaling pathway
    100464798 (NFATC2)
   04022 cGMP-PKG signaling pathway
    100464798 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100464798 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100464798 (NFATC2)
   04650 Natural killer cell mediated cytotoxicity
    100464798 (NFATC2)
   04660 T cell receptor signaling pathway
    100464798 (NFATC2)
   04658 Th1 and Th2 cell differentiation
    100464798 (NFATC2)
   04659 Th17 cell differentiation
    100464798 (NFATC2)
   04662 B cell receptor signaling pathway
    100464798 (NFATC2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100464798 (NFATC2)
  09158 Development and regeneration
   04360 Axon guidance
    100464798 (NFATC2)
   04380 Osteoclast differentiation
    100464798 (NFATC2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100464798 (NFATC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100464798 (NFATC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100464798 (NFATC2)
   05170 Human immunodeficiency virus 1 infection
    100464798 (NFATC2)
   05161 Hepatitis B
    100464798 (NFATC2)
   05163 Human cytomegalovirus infection
    100464798 (NFATC2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100464798 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100464798 (NFATC2)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100464798 (NFATC2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 100464798
NCBI-ProteinID: XP_019655150
LinkDB
Position
13
AA seq 701 aa
MSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAGALVAPLPGASPQRSRSPSPQP
RDDGAPAGYPPTAGSAVLMDALNSLAADSPCGIPPKMWKTSPDPSPVSAAPPKAGLPRHI
YPAVEFLGPCEQEEGRSSAPESILLVPPTWPKQLVPAIPICSIPVTASLPPLEWPLSHQS
GSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADE
RILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNAD
IELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDI
DSCLVYGGQQMILTGQNFTAESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEY
RNKHIRASVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPAHGGLGSQ
PYYPQHPMVAESPSCLVATMAPCQQFRSGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGY
QQPALMAAPLSLAEAHRSVLVHTGPQGQSSGLLHSSPANQQASPVIHYSPTHQPPRCGSH
QEFQHIMYCENFAPGPARPGPPPAVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQ
KEVLPAGVTIKQEQNLDQTYLDDVNEIIRKEFSGPPARNQT
NT seq 2106 nt   +upstreamnt  +downstreamnt
atgtcacctcgaaccagcctcgctgaagacagctgcctgggccgccactcgcccgtgccc
cgtccggcctcccgctcctcgtcgcctggtgccaagcggaggcattcgtgtgctggggcc
ttggttgccccgctgcccggagcctcaccccagcgctcccggagcccctcgccgcagccc
cgggacgacggcgctcccgctgggtacccccccacggctggctctgccgtcctcatggat
gccctgaacagcctcgccgcggattcgccttgtggcatcccccccaagatgtggaagacg
agccccgacccatcgccggtgtccgccgccccgcccaaagccggcctgccccgccacatc
tacccggccgtggagttcctggggccctgcgagcaggaggaggggaggagctcggcccct
gagtccatcttgctggtgccgcccacctggcccaagcagctggtgcctgcgattcccatc
tgcagcatcccagtgaccgcatccctccctcctctggagtggccgctctcccaccagtcg
gggtcctatgagctgcggatcgaggtgcagcccaagccacatcaccgggcccactatgag
acggaaggcagtcgaggggctgtcaaagctccaactggtggccaccctgtcgttcagctc
catggctacatggaaaacaagcccctggggcttcagatcttcattgggacagctgatgag
cggatcctcaagccccatgccttctaccaggtgcaccggatcacgggcaaaaccgtcacc
accaccagctacgagaaaatcgtgggcaacaccaaagtcctggagatccctctagagcca
aaaaacaacatgagggcgaccatcgattgcgcggggatcctgaagcttcggaacgccgac
atcgagctgcggaaaggggagacggacatcggccggaagaacacgcgggtgcggctggtg
ttccgagtgcacattccagagtccagtgggaggatcgtctccctgcagactgcgtcgaac
cccatcgagtgctcccagcggtcggcccacgagctgcccatggtggagagacaagacatc
gacagctgcctggtttacgggggtcagcagatgattctcaccggacagaacttcacggcc
gagtccaaagtcgtgttcactgagaagaccacagatgggcagcaaatttgggagatggaa
gctacggtggataaagacaagagccagcccaacatgctttttgttgagatccctgagtat
cgaaacaagcacatccgtgcgtcggtgaaggtgaacttctatgtcatcaatgggaagaga
aaacgaagtcagccgcagcactttacctaccacccagtcccagccatcaagacggagccc
acagatgaatatgaccccacgttgatctgcagccctgcccacgggggcctggggagccag
ccctactacccgcagcacccgatggtggccgaatccccctcctgcctcgtggccaccatg
gcgccctgccagcagttccgctcggggctctcgtcccccgacgcccgctaccagcagcag
aacccggcggccgtcctctaccagcggagcaagagcctgagccccagcctgctgggctac
cagcagccggccctcatggccgccccgctgtccctggctgaggcccaccgctctgtgctg
gtgcacaccggcccccagggccagagctccggcctgctgcactcctccccggccaaccag
caggcctcgccggtgatccactactcgcccacccaccagcccccgcgctgcggcagccac
caggaattccagcacatcatgtactgcgagaacttcgcgcccggccccgccaggcccggc
ccgccgcccgccgtcagtcaagggcagaggctgagcccggggtcctaccccacggtcatt
cagcagcagaatgccaccagccaaagagccgccaaaaacggacccccagtcagtgaccaa
aaggaagtattacccgcaggagtgacgattaaacaggagcagaacttggaccagacctac
ttggatgatgttaatgaaattatcaggaaggagttttcaggacctcccgccagaaatcag
acatag

KEGG   Ailuropoda melanoleuca (giant panda): 100470861
Entry
100470861         CDS       T01329                                 

Gene name
NFATC1
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1 isoform X2
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04218  Cellular senescence
aml04310  Wnt signaling pathway
aml04380  Osteoclast differentiation
aml04625  C-type lectin receptor signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04921  Oxytocin signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05135  Yersinia infection
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100470861 (NFATC1)
   04310 Wnt signaling pathway
    100470861 (NFATC1)
   04024 cAMP signaling pathway
    100470861 (NFATC1)
   04022 cGMP-PKG signaling pathway
    100470861 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100470861 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100470861 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    100470861 (NFATC1)
   04660 T cell receptor signaling pathway
    100470861 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    100470861 (NFATC1)
   04659 Th17 cell differentiation
    100470861 (NFATC1)
   04662 B cell receptor signaling pathway
    100470861 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100470861 (NFATC1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100470861 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100470861 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100470861 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100470861 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100470861 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100470861 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    100470861 (NFATC1)
   05161 Hepatitis B
    100470861 (NFATC1)
   05163 Human cytomegalovirus infection
    100470861 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100470861 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100470861 (NFATC1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100470861 (NFATC1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 100470861
NCBI-ProteinID: XP_011224700
Ensembl: ENSAMEG00000010314
LinkDB
Position
14
AA seq 889 aa
MTGLEEDQEFDFDFLFEFNQSDEGTAAAPEHYSYAPSSISSALPPGSAHPSLPAPCHDLQ
TSAPGMPAAAASQPPGYGGPVDSGPSSYFLPSSHVRPNGAPALESPRIEITSYMGLHHGN
NQFFHDVAVEEVIPSSKRPPSTATLNLPNLEAYRDPSCLSPASSLSSRSCNSEASSYESN
FSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACGLLGSPRHSPSTSPRTSVTEESWL
GARTSRPSSPCNKRKYGLNGRQLSCSPHHSPTPSPRSSPRVSVTDDTWLGNSTQYTSSAI
VAAINALSTDSSLELDGVPVKARKTTLDHCPSVALKVEPAGEDLGTTPPTSEFLPEEFPS
FQHIRKGAFCDQYLSVPQHPYQWARPRSPTSYTSPSLPALDWQLPSRSGPYELRIEVQPK
PHHRAHYETEGSRGAVKASAGGHPSVQLHGYLENEPLTLQLFIGTADDRLLRPHAFYQVH
RITGKTVSTTSHEAILSNTKVLEIPLLPENNMRAIVDCAGILKLRNSDIELRKGETDIGR
KNTRVRLVFRVHIPQPNGRTLSLQVASNPIECSQRSAQELPLVEKQSTASCPVLGGKKMV
LSGHNFLQDSKVIFVEKAPDGHHIWEMEAKLDRDLCKPNSLVVEIPPFRNQRITSPVQVS
FYVCNGKRKRSQYQHFTYLPANAPTIKTEPTDDYQPVLTCGPMSQGPSPLPKPCYSQQLA
MPSDPGSCLVAGFPSCPQRSTVVSPPPSTSPKLHDLSSATYSKGMASPGHSHLGLQRPAG
GVLAVPETPRPVGAHPGPPQQPPPALLRPQSCSPTHPSEMGHQQHRLRKAPRSESAAPRP
LPLPEAREDSNHSLAPIPVTVKREPQELDQLYLDDVNEIIRNDLSSTNI
NT seq 2670 nt   +upstreamnt  +downstreamnt
atgacggggctggaggaggaccaggagttcgacttcgatttccttttcgagtttaaccag
agcgacgaaggcaccgccgctgccccagaacactatagttatgcaccctctagcatcagc
tctgctctgcctcccggctcggctcacccctcgctgccggcgccgtgccacgacctgcag
acctcggccccaggcatgccggccgccgcggcaagtcagcccccgggctacggtgggccg
gtggacagcgggccctcgagctactttctcccctccagccacgtcaggcccaacggggcc
cccgccctagagagccctcgcatcgagatcacctcctacatgggactgcaccatggtaac
aaccagtttttccacgatgtggcggtggaagaagtcattcccagctccaagcggcccccg
tccacggccaccctgaatctgcccaacctggaggcctaccgagacccctcctgcctgagc
ccggccagcagcctgtcctcccgcagctgcaactctgaggcctcgtcctacgagtccaac
ttctcgtacccctacgcatccccgcagacgtccccgtggcagtcgccctgtgtgtccccc
aagaccacggaccccgaggagggcttcccccgtggcctgggggcctgcggcctgctcggc
tcccccagacactcgccctccacctcgccccgcacgagcgtcacggaggagagctggctg
ggggcccgcacgtcccggccctcgtctccctgcaacaagaggaaatacggcctcaacggc
cggcagctgtcctgctccccgcaccactcgcccacgccgtccccacgcagctcgccgcgg
gtcagtgtcaccgacgacacctggctgggcaacagcacacagtataccagctccgccatc
gtggccgccatcaacgccctcagcaccgacagcagcctggagctggacggcgtccccgtg
aaggcacgcaagaccaccctagaccattgtccctcggtggcactcaaggtggagccagca
ggcgaggacctggggaccacgccgcccacgtccgagttccttcccgaagagttcccgtcc
ttccagcacatccggaagggggctttctgcgaccagtacctgtcggtgccgcagcacccg
taccagtgggccaggccccggtccccgacatcctacaccagcccgtccctccccgccctg
gactggcagctgccgtcgcgctcgggaccctacgagctgaggatcgaggtgcagcccaag
ccccaccacagagcccactatgagacggaggggagccggggggctgtgaaggcgtcagcc
ggaggacaccccagcgtgcagctacacggctacttggagaatgagccactcacactacag
ctgttcattgggacggccgacgaccgcctgctgagaccccacgccttctaccaggtccac
cggatcacaggcaagaccgtctccaccaccagtcatgaagccatcctctccaacaccaaa
gtcctggaaatcccactgctgccagagaacaacatgcgagccattgtggactgtgccggg
attttgaagctcagaaactcggacatcgagctgcggaaaggggagacggacatcgggagg
aagaacaccagggtgaggctggtcttccgcgtccacatcccgcagcccaacggccggacg
ctgtccttgcaagtggcctcgaaccccatcgagtgctcccagcggtcggcccaggagctg
cccctcgtggagaagcagagcacggccagctgccccgtgctcggcggcaagaagatggtc
ctgtctggccacaacttcctgcaggactccaaagtcatttttgtggagaaggcaccagac
ggtcaccacatctgggaaatggaggcgaagctggacagagacctgtgcaagccgaactcg
ctggtggtcgagatcccaccttttcgcaatcagagaataaccagccccgtccaagtcagt
ttctatgtctgcaacgggaagagaaagagaagccagtaccagcacttcacctaccttcct
gcgaacgctccaaccataaaaacagagcccactgatgattaccagcctgtcctgacctgc
ggaccaatgagccagggcccgagcccgctccccaagccgtgctatagccagcagctggcg
atgccgtctgacccgggctcctgccttgtggccggcttcccgtcctgtccgcagaggagc
actgtggtgtcaccgccacccagcaccagcccgaagctccacgacctctcttccgccacc
tacagcaagggcatggccagcccaggccacagtcacctcggacttcagcgcccagccgga
ggcgtccttgccgttccggagacgcctagacccgtgggcgcgcaccccggccccccccag
cagccgcctcccgccttgctgcggccacagtcctgcagccccacccacccatccgagatg
ggccaccagcagcaccgactccggaaggctccgaggagcgagtccgcagccccccggcct
ctgccgctgcccgaggcgcgtgaggacagtaatcatagtctggcccccattcccgtaacg
gtcaagcgagagcctcaggagttggaccagctgtacctggatgacgtaaatgaaataata
cgaaacgatctctccagcaccaatatctga

KEGG   Ailuropoda melanoleuca (giant panda): 100471691
Entry
100471691         CDS       T01329                                 

Gene name
NFATC4
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 4 isoform X1
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04022  cGMP-PKG signaling pathway
aml04218  Cellular senescence
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04625  C-type lectin receptor signaling pathway
aml04921  Oxytocin signaling pathway
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100471691 (NFATC4)
   04022 cGMP-PKG signaling pathway
    100471691 (NFATC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100471691 (NFATC4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100471691 (NFATC4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100471691 (NFATC4)
  09158 Development and regeneration
   04360 Axon guidance
    100471691 (NFATC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100471691 (NFATC4)
   05170 Human immunodeficiency virus 1 infection
    100471691 (NFATC4)
   05161 Hepatitis B
    100471691 (NFATC4)
   05163 Human cytomegalovirus infection
    100471691 (NFATC4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100471691 (NFATC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100471691 (NFATC4)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100471691 (NFATC4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 100471691
NCBI-ProteinID: XP_034504425
Ensembl: ENSAMEG00000015941
LinkDB
Position
20
AA seq 854 aa
MHSPPPRPAPSPGTWESQPARSVRLGGPGGASGGPGGGRVLECPSIRITSISPTPDPPAA
LEDNPDAWGDGSPRDYPPPEGFGGYRETGGQGGGPFFSPSPGSSSLSSWSFFSDASDEAA
LYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPDDPWNLYGPSPGGRGPEDSWLLL
SAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGPEPPPPPPLPLARDPG
SPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRSEEPAPCNGKLQSGAEETAAPPGGARK
EVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELRIEVQPRAHHR
AHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLALQMFIGTADERNLRPHAFYQVHRITGK
MVATASYEAIVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGETDIGRKNTRV
RLVFRVHVPQGSGKVVSVQTASVPIECCEQRGPVPAVCLLPLPLCVLSVLAQRSAQELPQ
VEAYSPSACSVRGGEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLT
LTVPEYSNKRVSRPVHVYFYVSNGRRKRSPTQSFKFLPVIFKEEPLPDSSLRGFPSAPGP
PFGTDMDFSPPRPPYPSYPHEDPAYETPYLSEGFSYGTPPLYPQTGPPPSYRPGLRMFPE
TGGATGCARPPPVSFLPRPFPSDPYGGRGSPFSLGLPFPPPAPFRPPLPSSPPLEGPFPP
QSGVHPPPAEGYNEVGPSYGPGEGAPEQEKSRGGYGSGFRDSVPIQGITLEEVSEIIGRD
LSGFPAPPGEEPPA
NT seq 2565 nt   +upstreamnt  +downstreamnt
atgcattcgccaccaccccgcccggccccctcacctggcacttgggagagccagccagcc
cggtcagtgaggctggggggcccgggaggggcttccggggggcctgggggaggccgtgtt
cttgaatgccccagcatccgcatcacctccatctctcccacacctgacccgccggccgcg
ctggaggacaaccccgatgcctggggggacggctcccccagggattacccgccaccagaa
ggcttcgggggctaccgagagacagggggccagggcgggggccccttcttcagccccagc
ccgggcagcagcagcctgtcctcgtggagcttcttctccgacgcttcagacgaggcagcc
ctgtatgcggcctgcgacgaggtggagtctgagctaaatgaggcagcctcacgctttggc
ctgggctcccccttgccctcgcctcgggcctcccctaggccgtggacccccgacgatccc
tggaacctgtatggtccgagccccggaggccgggggccagaggatagctggctactcctc
agcgctcctgggcccaccccagcctccccacggcccgcctctccatgtggcaagcggcgc
tattccagctcgggaaccccgtcttcggcctccccagctctgtcccgccgcggtagcctg
ggggaggaggggcccgagccacctccaccacccccattgcctctggcccgggatcctggc
tcccccggcccttttgactacgtgggagctccgccggcggagagcatcccgcagaagacc
cggcgaacttccagcgagcaggcagtggccctgcctcggtctgaggagcctgccccgtgc
aatgggaagctgcagtcaggagccgaggagactgcagcgccccccgggggtgctcggaag
gaggtggccggcatggactacctggcagtgccttccccactggcttggtccaaggcccgg
attgggggacacagccccatcttcaggacctctgccctacccccgctggactggcctcta
cccagccagtatgagcagctggagctgaggattgaggtgcagcccagagcccaccaccgg
gcccactatgagactgagggcagccgaggagctgtcaaagccgcccccggtggtcaccct
gtagtcaagctcctagggtacagtgagaagccgctggccctacagatgttcattggtact
gcggatgaaaggaacctgcggccccacgccttctaccaggtgcaccggatcacgggcaag
atggtggccacggctagctacgaagccatagtcagtggtaccaaagtgttggagatgacc
ctgcttcctgagaacaacatggcagccaacattgactgtgctggaatcctgaagctccgg
aattcagacatcgagctgcggaagggggagacagacatcgggcgcaagaacacacgagtg
cggctcgtgttccgggtgcacgtgccccagggcagcgggaaggtcgtctcagtgcagaca
gcatcagtgcccattgagtgctgtgagcaaagaggccctgtgccagctgtgtgtctcttg
ccgctccctctctgtgtcctgtctgtcctagcccagcgctcagcccaggagctgccccag
gtggaggcatacagccccagtgcctgctccgtgagaggaggagaggaactagtgctcact
ggctccaacttcctgccagactccaaggtggtgttcatcgagaggggccctgatggaaag
ctgcagtgggaggaggaggccacggtgaaccggttgcagagcaatgaggtgacgctgacc
ctgactgtccccgagtacagcaacaagcgggtgtcccggccagtgcacgtctacttttat
gtctccaatgggcggaggaagcgcagtcctacccagagtttcaagttcctgcctgtgatc
ttcaaggaggagcctttaccggactcatctctccgaggcttcccttccgcacctggcccc
ccctttggcactgacatggacttctcaccacccaggcccccttacccctcctatccccac
gaagaccctgcttatgaaactccttacctgtcagaaggcttcagctatggcacaccccct
ctgtacccccagacggggcccccaccatcctacagacctggcctgcggatgttccctgag
actgggggtgccacaggttgtgcccgcccacctccagtctccttccttccccggcccttc
cctagtgacccctatggaggacggggctccccattttccttggggctgccattccctcct
ccagccccctttcggcctccactgccttcatccccaccacttgaaggccccttccctccc
cagagtggtgttcaccccccacctgctgagggatacaatgaggtagggccaagctatggc
cctggggagggggctccggagcaggagaaatccaggggtggctacggcagcggcttccga
gacagtgtccctatccagggtatcacgctggaggaagtgagtgagatcattggccgagac
ctgagtggcttccctgcacctcccggagaagagcctcctgcctga

KEGG   Ailuropoda melanoleuca (giant panda): 100477832
Entry
100477832         CDS       T01329                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3 isoform X1
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04218  Cellular senescence
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04625  C-type lectin receptor signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04921  Oxytocin signaling pathway
aml05135  Yersinia infection
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100477832 (NFATC3)
   04310 Wnt signaling pathway
    100477832 (NFATC3)
   04022 cGMP-PKG signaling pathway
    100477832 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100477832 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100477832 (NFATC3)
   04660 T cell receptor signaling pathway
    100477832 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    100477832 (NFATC3)
   04659 Th17 cell differentiation
    100477832 (NFATC3)
   04662 B cell receptor signaling pathway
    100477832 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100477832 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    100477832 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100477832 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100477832 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100477832 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    100477832 (NFATC3)
   05161 Hepatitis B
    100477832 (NFATC3)
   05163 Human cytomegalovirus infection
    100477832 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100477832 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100477832 (NFATC3)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100477832 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 100477832
NCBI-ProteinID: XP_034494381
Ensembl: ENSAMEG00000008086
LinkDB
Position
12
AA seq 1075 aa
MTTANCGAHDELDFKLVFGEDGAPAPPPSGSRPADLEPDDCASIYIFNVDPPPSTLNSPL
CLPHHGLPSHSSVLSPSFQLQGHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNC
HQEIDAHEDDLHINDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEESWHQQYGLGHSLSPRQS
PCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHS
PRGSITEDTWLNASVQGGSGLGPALFPFQYCVETDIPLKTRKTSEDQATVLPGKLELCSD
DQGNLSPSRETSIDDGLGSQYPLKKDSSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL
DWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYSEKPINLQM
FIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGI
LKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGKVLSLQTASIPVECSQRSAQELP
HIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAHI
VLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHKEEVDLSSVPALSV
PHPAQTQRPSSDTGHPRDSVLSAQRSLVCPIQQTYASMVTSSHLPQLQCRDESGGKEQHM
IPSSVMHQPFQVTSTPPVGSSYQPMQTNVVYNGPTCLPVNAASSQEFDPVLFPQDAALPS
LINLGCQPPSSIPFHSSNSGPTGHLLAHTPHSVQTLPHLQSMGFHCSNTGQRSLSSPGAD
RVTGQPSPQLQPITYSPSHSGSATTASPAVSHPLASSPLSGPPSPQLQPMPYQSPSSGTA
SSPSLATRMHSGQHSTQAQSTGQGGLSAPSSLICHNLCDPASFPPDEATVNIKPEPEEQE
PNFSTIGLQDITLDDVNEIIGRDMSQISVSQGTGASRQAPLPGPDSLDIGRSDGL
NT seq 3228 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgacttcaaactcgtctttggcgag
gacggggcgcctgcgccgccgccctcgggctcgcggcctgcagatcttgagccagatgat
tgtgcatccatttacatctttaatgtagatccacctccatctactttaaactcaccactt
tgcttaccacatcatggattaccgtctcactcttctgttttgtcaccatcgtttcagctc
caaggtcacaaaaactatgaaggaacttgtgagattcctgaatctaaatacagcccatta
ggtggtcccaaaccttttgagtgcccaagtattcaaattacatccatctctcctaactgt
catcaagaaatagatgctcatgaagatgacctacacataaatgacccagaaagggaatat
ttggaaaggccttctagagatcatctctatcttcctcttgagccatcctaccgggagtct
tcccttagtcctagtcctgccagcagtatatcttctaggagctggttctcagatgcatct
tcttgtgaatctctttcacacatttatgatgatgtggattcggagttgaatgaagctgct
gcccgatttactctcggatcccctctgacttctcctggtggctcgccaggaggctgccct
ggagaagagtcctggcatcaacaatatggacttggacactccttgtcacccaggcaatct
ccttgccactctcctagatctagtgtcactgatgagaattggctgagccccaggccagcc
tcagggccctcatcaaggcctacttccccatgtgggaaacgacggcactccagtgctgag
gtttgttatgctgggtccctttcaccccatcactcacctgttccttctcctggtcactcc
ccgaggggaagtataacagaagatacctggcttaatgcttctgtccagggtggatcaggc
cttggccctgcactttttccatttcagtactgtgtagagactgatatccctctgaaaaca
aggaagacttctgaagatcaagctactgtactaccaggaaaattagagctctgttcagat
gaccaagggaatttatcaccatcccgggagacttcaatagatgatggccttggatctcag
tatcctttaaagaaagattcatctggtgaccaatttctttccgttccttcaccttttacg
tggagcaaaccaaagcctggccacaccccaatatttcgcacatcttcattacctccacta
gactggcctttaccaactcattttggacaatgtgaactgaaaatagaagtgcaacctaaa
actcatcatagagcccattatgaaactgaaggtagtcgaggagcagtaaaagcgtctact
ggggggcatcctgttgtaaagctcctgggctatagtgaaaagccgataaatctacagatg
tttattggaacagcagatgatcgatatttacggcctcatgcattttaccaggtgcatcga
atcactgggaagactgttgctactgcaagtcaagagataataattgccagcacaaaggtt
ctggaaattccccttcttcctgaaaacaatatgtcagccagtattgactgtgcaggtatt
ttgaaactccgcaattcagatatagaacttcgaaaaggagaaaccgatattggcagaaag
aatactagagtacgactcgtgttccgtgtgcacatcccacagcccaatgggaaagtcctt
tctctgcagacagcttccatacctgttgagtgctctcagcggtctgctcaagaacttcct
catattgagaagtacagtatcaacagttgttctgtaaatggaggtcatgaaatgattgtg
actggatctaatttccttccagaatccaaaatcatttttcttgaaaaaggacaagatgga
cgacctcagtgggaggtagaagggaaaataatcagggaaaaatgtcaaggggctcacatt
gtccttgaagttcctccatatcataacccagcagttacagctgcagtgcaggtgcacttt
tatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttatacaccagtt
ttgatgaagcaggaacacaaagaagaggttgacttgtcttcagttccagcattgtctgtt
cctcatcctgcccagacccagaggccttcctcagacacaggacacccacgtgacagtgta
ctgtcagcacagagaagcttggtttgtcccatccagcaaacatatgcatccatggtaact
tcatctcatctgccacagttgcagtgtagggatgaaagtggtggtaaagaacagcatatg
ataccttcttcagttatgcaccagccttttcaagtcacatcaacacctcctgtggggtct
tcctatcagcctatgcaaactaatgttgtgtacaacggaccaacttgtcttccagttaat
gctgcctctagtcaagaatttgatccggttttgtttccacaggatgcagctcttcctagt
ttaataaaccttggttgtcagccaccatcatccataccttttcattcttcaaattcaggc
ccaacaggacatctcttagcccacacacctcattcggtgcagaccctgcctcacctgcag
tcaatgggattccattgttcaaacacaggacaaagatctctttcttctccaggggctgac
cgggtcacaggccagccttcccctcagttacagcccattacatatagtccttcacattcg
gggtctgctacaaccgcttccccagcagtctctcatcccctggctagttcaccactttct
gggccaccatctcctcagctacagcctatgccttaccaatctcctagctcaggaactgcc
tcttcaccgtctctagccaccagaatgcattctggacagcactcaactcaagcacaaagt
actggccagggaggtctttctgcaccttcatccttaatatgtcacaatttgtgtgatcca
gcttcatttccacctgatgaggcaactgtgaacattaagcctgaacctgaagagcaggaa
cctaacttttcaacaattggtctgcaggacatcactttagatgatgtgaacgagataatt
gggagagacatgtcccagatttctgtttcccaaggaacaggggcgagcaggcaggctccc
ctcccggggcccgattccctggatataggaagatccgatgggctttga

DBGET integrated database retrieval system