KEGG   Ailuropoda melanoleuca (giant panda): 100464853
Entry
100464853         CDS       T01329                                 

Gene name
GNAQ
Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04062  Chemokine signaling pathway
aml04071  Sphingolipid signaling pathway
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04371  Apelin signaling pathway
aml04540  Gap junction
aml04611  Platelet activation
aml04713  Circadian entrainment
aml04720  Long-term potentiation
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04726  Serotonergic synapse
aml04728  Dopaminergic synapse
aml04730  Long-term depression
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04924  Renin secretion
aml04925  Aldosterone synthesis and secretion
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04929  GnRH secretion
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04961  Endocrine and other factor-regulated calcium reabsorption
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml04972  Pancreatic secretion
aml05010  Alzheimer disease
aml05016  Huntington disease
aml05017  Spinocerebellar ataxia
aml05022  Pathways of neurodegeneration - multiple diseases
aml05135  Yersinia infection
aml05142  Chagas disease
aml05143  African trypanosomiasis
aml05146  Amoebiasis
aml05163  Human cytomegalovirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100464853 (GNAQ)
   04371 Apelin signaling pathway
    100464853 (GNAQ)
   04020 Calcium signaling pathway
    100464853 (GNAQ)
   04071 Sphingolipid signaling pathway
    100464853 (GNAQ)
   04022 cGMP-PKG signaling pathway
    100464853 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100464853 (GNAQ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100464853 (GNAQ)
   04062 Chemokine signaling pathway
    100464853 (GNAQ)
  09152 Endocrine system
   04911 Insulin secretion
    100464853 (GNAQ)
   04922 Glucagon signaling pathway
    100464853 (GNAQ)
   04929 GnRH secretion
    100464853 (GNAQ)
   04912 GnRH signaling pathway
    100464853 (GNAQ)
   04915 Estrogen signaling pathway
    100464853 (GNAQ)
   04921 Oxytocin signaling pathway
    100464853 (GNAQ)
   04935 Growth hormone synthesis, secretion and action
    100464853 (GNAQ)
   04918 Thyroid hormone synthesis
    100464853 (GNAQ)
   04928 Parathyroid hormone synthesis, secretion and action
    100464853 (GNAQ)
   04916 Melanogenesis
    100464853 (GNAQ)
   04924 Renin secretion
    100464853 (GNAQ)
   04925 Aldosterone synthesis and secretion
    100464853 (GNAQ)
   04927 Cortisol synthesis and secretion
    100464853 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100464853 (GNAQ)
   04270 Vascular smooth muscle contraction
    100464853 (GNAQ)
  09154 Digestive system
   04970 Salivary secretion
    100464853 (GNAQ)
   04971 Gastric acid secretion
    100464853 (GNAQ)
   04972 Pancreatic secretion
    100464853 (GNAQ)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100464853 (GNAQ)
  09156 Nervous system
   04724 Glutamatergic synapse
    100464853 (GNAQ)
   04725 Cholinergic synapse
    100464853 (GNAQ)
   04728 Dopaminergic synapse
    100464853 (GNAQ)
   04726 Serotonergic synapse
    100464853 (GNAQ)
   04720 Long-term potentiation
    100464853 (GNAQ)
   04730 Long-term depression
    100464853 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    100464853 (GNAQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100464853 (GNAQ)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100464853 (GNAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100464853 (GNAQ)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100464853 (GNAQ)
   05016 Huntington disease
    100464853 (GNAQ)
   05017 Spinocerebellar ataxia
    100464853 (GNAQ)
   05022 Pathways of neurodegeneration - multiple diseases
    100464853 (GNAQ)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100464853 (GNAQ)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100464853 (GNAQ)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100464853 (GNAQ)
   05163 Human cytomegalovirus infection
    100464853 (GNAQ)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100464853 (GNAQ)
   05142 Chagas disease
    100464853 (GNAQ)
   05143 African trypanosomiasis
    100464853 (GNAQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100464853 (GNAQ)
   04031 GTP-binding proteins [BR:aml04031]
    100464853 (GNAQ)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100464853 (GNAQ)
GTP-binding proteins [BR:aml04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    100464853 (GNAQ)
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 100464853
NCBI-ProteinID: XP_034502971
LinkDB
Position
17
AA seq 324 aa
MTSFAVVHLAGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMD
TLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSD
STKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRK
WIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNK
KDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTE
NIRFVFAAVKDTILQLNLKEYNLV
NT seq 975 nt   +upstreamnt  +downstreamnt
atgacatcttttgctgttgtccatcttgcagggacaggagagagtggcaagagtacgttt
atcaagcagatgagaatcatccacgggtcgggctactctgacgaagacaaaaggggcttc
accaagctggtgtatcaaaacatcttcacggccatgcaggccatgatcagagccatggac
acgctcaagatcccctacaagtacgagcataataaggctcatgcacagttagttcgagaa
gttgacgtggagaaggtgtctgcttttgagaatccgtacgtagatgcaataaagagttta
tggaatgatcctggaatccaggaatgctacgatagacgacgagagtatcagttgtctgac
tctaccaaatactatcttaatgacttggaccgcgtcgctgaccccgcctacctgcctacg
caacaagacgtgcttagagttcgagtccccaccacagggatcatcgagtacccctttgac
ttacaaagtgtcattttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaa
tggatacactgctttgaaaatgtcacctctatcatgtttctagtagcgcttagtgaatat
gatcaagttctcgtggagtcggacaatgagaaccgaatggaggaaagcaaagcactcttt
agaacaattatcacgtatccctggttccagaactcctcggttattctattcttgaacaag
aaagatcttctagaggagaaaattatgtattcccacctagttgactacttcccggaatat
gatggaccccagagagatgcccaggcagctcgagaattcatcctgaagatgttcgtggac
ctgaacccagacagtgacaaaattatctactcccatttcacgtgcgccacagacaccgag
aacatccgctttgtcttcgctgccgtcaaggacaccatcctccagttgaacctgaaggag
tacaatctggtgtga

DBGET integrated database retrieval system