KEGG   Ailuropoda melanoleuca (giant panda): 100464991
Entry
100464991         CDS       T01329                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04072  Phospholipase D signaling pathway
aml04144  Endocytosis
aml04151  PI3K-Akt signaling pathway
aml04510  Focal adhesion
aml04540  Gap junction
aml04630  JAK-STAT signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05163  Human cytomegalovirus infection
aml05200  Pathways in cancer
aml05206  MicroRNAs in cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100464991 (PDGFRA)
   04014 Ras signaling pathway
    100464991 (PDGFRA)
   04015 Rap1 signaling pathway
    100464991 (PDGFRA)
   04630 JAK-STAT signaling pathway
    100464991 (PDGFRA)
   04020 Calcium signaling pathway
    100464991 (PDGFRA)
   04072 Phospholipase D signaling pathway
    100464991 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100464991 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100464991 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100464991 (PDGFRA)
   04540 Gap junction
    100464991 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100464991 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100464991 (PDGFRA)
   05206 MicroRNAs in cancer
    100464991 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100464991 (PDGFRA)
   05231 Choline metabolism in cancer
    100464991 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    100464991 (PDGFRA)
   05218 Melanoma
    100464991 (PDGFRA)
   05215 Prostate cancer
    100464991 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100464991 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100464991 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100464991 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:aml04090]
    100464991 (PDGFRA)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100464991 (PDGFRA)
Protein kinases [BR:aml01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100464991 (PDGFRA)
CD molecules [BR:aml04090]
 Proteins
  100464991 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like LAT
Other DBs
NCBI-GeneID: 100464991
NCBI-ProteinID: XP_002919416
Ensembl: ENSAMEG00000018351
LinkDB
Position
11
AA seq 1090 aa
MMRTSLLGFLILGCLLTGPSRIFCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQY
PMSEEENPNVEIRNEENNSGLFVAVLEVVNASAAHTGLYTCYYNHTQTEETDVEGRRIYI
YVPDPDVAFVPLGMTDYLVIVENDDSAIIPCRTTDPKTPVTLRSNDRVVHASYDSRQGFN
GTFSVGPYICEATVRGKKFQTIPFNIYSLKATSELDLEMEALKTVYKSGETIVVTCAVFN
NEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLRVPEATVKDSGDYECAARQATKEV
KEMKKVTISVYEKGFIEIKPNFSPLEAVDLHEVKHFVVDVQAYPPPRISWLKDNLTLIEN
LTEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILD
LVDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWVILASNISNIITEVHPR
DRNTVEGRVTFTRVEETIAVRCLAKNLLGAQSRELKLVAPTLRSELTVAAAVLVLLVIVI
ISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRIL
GSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVN
LLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADDSTRS
YVILSFENNGDYMDMKQADATQYVPMLERKEAAKYSDVQRSLYDRPASSKKKSVLDSEVK
NLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGL
ARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGM
MVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWHSEPEKRPSFYHLSEIVENLLPGQYK
KSYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGSLDEQRLSADSGYI
IPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGID
SSDLVEDSFL
NT seq 3273 nt   +upstreamnt  +downstreamnt
atgatgaggacttcccttctgggcttcctgatcttaggctgtctcctcacagggcccagc
cgaatcttctgccagctttcattaccctccatcctgccaaacgaaaatgaaaaggtcgtg
cagctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtac
cccatgtctgaagaagagaaccccaatgtggaaatcagaaacgaggagaacaacagtggc
ctttttgtggccgtgctggaagtggtcaacgcgtcggcggcacacacgggcttgtacact
tgctattacaaccacacgcagacggaggagaccgacgtcgagggccggcgtatctacatc
tatgtgccagacccggatgtagcctttgtgcctctgggaatgacagattatttagtcatc
gtggagaatgatgattctgccatcataccatgtcgcacgactgatcccaagactccggtc
accttgcgcagcaatgacagggtggtgcacgcctcctatgacagcagacagggcttcaat
gggaccttcagcgttgggccctatatctgtgaagccaccgtcaggggaaagaagttccag
accatcccatttaatatttattctttaaaagcaacgtcagaacttgatctagaaatggaa
gctcttaaaactgtgtataagtcaggggagacgattgtggtcacctgcgccgtctttaac
aacgaggtggtcgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacc
atgctggaggaaatcaaggtcccgtccatcaaattggtgtatactctgagggtccctgag
gccacggtgaaagatagtggagattatgagtgtgctgcccgccaggccaccaaggaggtc
aaagagatgaagaaagtcaccatttctgtctatgagaaagggttcattgaaatcaaaccc
aacttcagcccattggaagctgtcgacctgcatgaagtcaaacatttcgtggtggatgtg
caggcctacccccctcccaggatatcctggctgaaggacaacctgactctgattgaaaat
ctcacggagatcaccacggacatagaaaagattcaggaaataaggtatcggagcaaatta
aagctgatccgtgctaaggaggaagacagtggccattacacgattgtcgttcaaaatgaa
gatgacgtgaagagctacactttcgaactcttaacgcaagttccctcatctattctggac
ttggtggacgaccaccacggctccacggggggacagaccgtgagatgcaccgctgaaggg
acacctcttcctgatatcgagtggatgatttgcaaggatattaagaagtgtaataatgaa
acttcatgggtgattttggccagcaatatctcaaacatcatcacggaggtccacccccga
gacaggaacactgtggagggccgagtgacgttcaccagagtggaggagaccatcgccgtt
cgatgtctggccaagaatctccttggggcccagagccgcgagctcaagctggtggccccc
acgctgcgctctgagctcactgtggccgctgccgtcctcgtgctgctggtgattgtgatc
atctcccttatcgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctgg
agggtcattgaatccatcagcccggatggacatgaatatatttatgtggacccaatgcag
ctgccttatgactcgagatgggagtttccaagagatggactagtgcttggtcgtatcctg
ggatctggcgcgtttgggaaagtggttgaaggaactgcctatggattaagccgctcccag
cctgtcatgaaggtagcagtgaagatgctgaaacccacagccagatccagtgagaaacag
gctcttatgtcggaactgaagataatgactcacctggggccgcatttaaacattgtgaac
ttgctgggagcctgtaccaagtcaggccctatttacatcatcactgagtactgcttctat
ggggatttggtcaactatttgcataagaatcgggatagcttcctgagccgccacccagag
aagccaaagaaagagctggacatttttggattgaaccctgccgacgacagcacacggagt
tacgtcattttatcttttgaaaacaatggtgactacatggacatgaagcaagctgacgcc
acccagtacgtccccatgctggaaaggaaagaggctgccaagtactcggacgtccagagg
tcgctgtatgatcgcccggcctcgtctaagaagaagtctgtgttagactcagaagtcaaa
aacctcctttcggatgataactcagaaggccttactttgttggatttgttgagctttacc
tatcaagttgcgcgaggaatggaatttttggcttcgaaaaattgtgtccaccgggacctg
gctgctcgaaacgtcctcctggcgcaagggaaaatcgtgaagatctgtgacttcggcctg
gccagagatatcatgcacgattcgaactacgtgtcaaaaggcagtacctttctccccgtg
aagtggatggcccctgagagcatcttcgacaacctctacaccacactgagtgacgtctgg
tcttacggcattctgctctgggagatcttttccctcggcggcacaccctaccccggcatg
atggtggattctactttctacaataagattaagagtgggtaccggatggccaagcctgac
cacgccaccagtgaagtctacgagatcatggtgaaatgctggcacagtgagccggagaag
agaccctccttctaccacctgagtgagattgtggagaatctgctgcccggacagtataag
aagagttacgaaaagattcacctggacttcctgaagagcgaccaccccgccgtggcgcgc
atgcgcgtggactcagacaacgcctacattggcgttacctacaaaaacgaggaagacaag
ctgaaggactgggagggcagcctggacgagcagaggctgagtgcggacagcggctacatc
atccccctgcccgacatcgaccctgtccctgaggaggaggacctgggcaagaggaacaga
cacagctcgcagacctccgaagagagcgctatcgagacaggttcgagtagctccaccttc
atcaagagagaggacgagaccatcgaggacatcgacatgatggatgacattggcatagac
tcctcagacctggtagaggacagtttcctgtga

DBGET integrated database retrieval system