KEGG   Ailuropoda melanoleuca (giant panda): 100464998
Entry
100464998         CDS       T01329                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04012  ErbB signaling pathway
aml04066  HIF-1 signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04350  TGF-beta signaling pathway
aml04371  Apelin signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04714  Thermogenesis
aml04910  Insulin signaling pathway
aml04931  Insulin resistance
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05221  Acute myeloid leukemia
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100464998 (RPS6KB2)
   04350 TGF-beta signaling pathway
    100464998 (RPS6KB2)
   04371 Apelin signaling pathway
    100464998 (RPS6KB2)
   04066 HIF-1 signaling pathway
    100464998 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    100464998 (RPS6KB2)
   04152 AMPK signaling pathway
    100464998 (RPS6KB2)
   04150 mTOR signaling pathway
    100464998 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100464998 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100464998 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100464998 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    100464998 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    100464998 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100464998 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100464998 (RPS6KB2)
   05205 Proteoglycans in cancer
    100464998 (RPS6KB2)
   05231 Choline metabolism in cancer
    100464998 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100464998 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100464998 (RPS6KB2)
   05212 Pancreatic cancer
    100464998 (RPS6KB2)
   05225 Hepatocellular carcinoma
    100464998 (RPS6KB2)
   05226 Gastric cancer
    100464998 (RPS6KB2)
   05221 Acute myeloid leukemia
    100464998 (RPS6KB2)
   05224 Breast cancer
    100464998 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100464998 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100464998 (RPS6KB2)
   05163 Human cytomegalovirus infection
    100464998 (RPS6KB2)
   05165 Human papillomavirus infection
    100464998 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100464998 (RPS6KB2)
   01522 Endocrine resistance
    100464998 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100464998 (RPS6KB2)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100464998 (RPS6KB2)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100464998 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 100464998
NCBI-ProteinID: XP_002921326
Ensembl: ENSAMEG00000000822
UniProt: G1L1X5
LinkDB
Position
16
AA seq 482 aa
MAAVFDLDLETEEGSEGEPELSPSDVCPLAESRAAGLEPVGHCEEMELTETSVNQGPERI
GPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAERNI
LESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLAL
GHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEILV
RSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLTLPPYLTPDARDLVKK
FLKRNPSQRIGGAPGDAADVQRHPFFRHINWDDLLARRVDPPFRPSLQSEEDVSQFDTHF
TRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRTPV
SPLKFSPFEGFRPSSGPLEPTEPSLPPLLPPPPPPPSSTAPLPIRPPSGTKKSKRGRGRP
GR
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcggcggtgtttgatctggacctggagacggaggaaggcagcgagggcgagccagag
ttgagcccctcggacgtgtgtccccttgccgagtcgagggcggctggcctggagcctgtg
ggacactgtgaggagatggagctcactgagaccagtgtgaaccagggccctgagcgcatc
gggccccactgctttgagctgctgcgtgtgctgggcaaggggggctatggcaaggtgttc
caagtgcgaaaggtgcaaggcaccaacttgggcaaaatatatgccatgaaagtcctgagg
aaggccaaaattgtgcgcaacgccaaggacacagcacacacgcgggctgaacggaacatt
ctagagtcagtgaagcaccccttcattgtggaactggcctatgccttccagactggtggc
aaactctacctcatcctcgagtgcctcagtggcggtgagctcttcacgcatctggagcga
gagggcatcttcctggaagacacggcctgtttctacctggcggagatcacgctggccctg
ggccatctccactcccaaggcatcatctaccgggacctcaaacctgagaacatcatgctt
aacagccagggccacatcaaactgacagactttggtctgtgcaaggagtcgatccacgag
ggtgccgtcacccacactttctgtggcaccattgagtacatggcccctgagattctggta
cgcagcggccacaaccgggcagtggactggtggagcctgggggccctgatgtatgacatg
ctcactggatcgccacccttcactgcggagaaccggaagaaaaccatggacaagatcatc
aaagggaagctgacgctgcccccctacctcacccccgatgcccgggaccttgtcaaaaag
tttctgaagcggaatcccagccaacggatcgggggggcccccggggatgctgctgatgtg
cagaggcacccgttcttccggcacattaattgggatgacctcctggctcgccgcgtagac
ccccctttcaggccctctctgcagtcagaggaggacgtgagccagtttgacacccacttc
acgcggcagacgccagtggacagtccagatgatacggccctcagtgagagcgcaaaccag
gccttcctgggcttcacatacgtggcaccctccgtcctggacagcatcaaggagggcttc
tccttccagcccaagctgcgctcccccaggcgcctcaacagcagcccccggaccccggtc
agccccctgaagttctcgccctttgagggattccggcccagctctggcccactggagccc
acggagccctctctacctcctctcctgccgccaccaccgccaccaccctcaagcactgcc
ccgctccccatccgacccccctcagggaccaagaagtctaagaggggccgtgggcgccca
ggccgctag

KEGG   Ailuropoda melanoleuca (giant panda): 100484786
Entry
100484786         CDS       T01329                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04012  ErbB signaling pathway
aml04066  HIF-1 signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04350  TGF-beta signaling pathway
aml04371  Apelin signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04714  Thermogenesis
aml04910  Insulin signaling pathway
aml04931  Insulin resistance
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05221  Acute myeloid leukemia
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100484786 (RPS6KB1)
   04350 TGF-beta signaling pathway
    100484786 (RPS6KB1)
   04371 Apelin signaling pathway
    100484786 (RPS6KB1)
   04066 HIF-1 signaling pathway
    100484786 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    100484786 (RPS6KB1)
   04152 AMPK signaling pathway
    100484786 (RPS6KB1)
   04150 mTOR signaling pathway
    100484786 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100484786 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100484786 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100484786 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    100484786 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    100484786 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100484786 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100484786 (RPS6KB1)
   05205 Proteoglycans in cancer
    100484786 (RPS6KB1)
   05231 Choline metabolism in cancer
    100484786 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100484786 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100484786 (RPS6KB1)
   05212 Pancreatic cancer
    100484786 (RPS6KB1)
   05225 Hepatocellular carcinoma
    100484786 (RPS6KB1)
   05226 Gastric cancer
    100484786 (RPS6KB1)
   05221 Acute myeloid leukemia
    100484786 (RPS6KB1)
   05224 Breast cancer
    100484786 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100484786 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100484786 (RPS6KB1)
   05163 Human cytomegalovirus infection
    100484786 (RPS6KB1)
   05165 Human papillomavirus infection
    100484786 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100484786 (RPS6KB1)
   01522 Endocrine resistance
    100484786 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100484786 (RPS6KB1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100484786 (RPS6KB1)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100484786 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100484786
NCBI-ProteinID: XP_002923359
Ensembl: ENSAMEG00000011391
UniProt: D2HLU3
LinkDB
Position
13
AA seq 525 aa
MRRRRRRDGFYPVPDFQDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
VEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagtgccggacttccaagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatttcggaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagcggaggagaatta
tttatgcagttagaaagagagggaatatttatggaagacacagcctgcttttacttggca
gaaatctccatggctttggggcatttgcatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccgttcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacgcaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcggcttggagctggtcct
ggggatgctggagaagttcaagctcatccattcttcaggcatattaactgggaagaactg
ctggctcggaaggtggagcccccctttaaacctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaaattttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccacgaacacctgtcagcccggtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacggcaaatcctcagacacctgtggaatatcccatggaaacaagtgga
gtagagcagatggatgtgacgatgagtggggaagcttcagcaccacttccaatacgacag
ccgaactccgggccatacaaaaaacaagcttttcccatgatctccaaacgaccagagcac
ctacgtatgaatctatga

DBGET integrated database retrieval system