KEGG   Ailuropoda melanoleuca (giant panda): 100465112
Entry
100465112         CDS       T01329                                 

Gene name
IKBKE
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit epsilon
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04623  Cytosolic DNA-sensing pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:aml00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100465112 (IKBKE)
   04621 NOD-like receptor signaling pathway
    100465112 (IKBKE)
   04622 RIG-I-like receptor signaling pathway
    100465112 (IKBKE)
   04623 Cytosolic DNA-sensing pathway
    100465112 (IKBKE)
   04625 C-type lectin receptor signaling pathway
    100465112 (IKBKE)
   04657 IL-17 signaling pathway
    100465112 (IKBKE)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100465112 (IKBKE)
   05160 Hepatitis C
    100465112 (IKBKE)
   05171 Coronavirus disease - COVID-19
    100465112 (IKBKE)
   05164 Influenza A
    100465112 (IKBKE)
   05162 Measles
    100465112 (IKBKE)
   05168 Herpes simplex virus 1 infection
    100465112 (IKBKE)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100465112 (IKBKE)
   05169 Epstein-Barr virus infection
    100465112 (IKBKE)
   05165 Human papillomavirus infection
    100465112 (IKBKE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100465112 (IKBKE)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100465112 (IKBKE)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100465112 (IKBKE)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH
Other DBs
NCBI-GeneID: 100465112
NCBI-ProteinID: XP_034523556
Ensembl: ENSAMEG00000011831
LinkDB
Position
8
AA seq 707 aa
MQSTVNYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTASYLRPHEVQVREFEVLR
KLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEEEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLMGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKTFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEMMYRITTE
KPAGAIAGAQRRENGPLEWSYSLPVTCRLSVGLQTQLVPILANILEVEQAKCWGFDQFFA
ETSDILQRVVVHVFSLSQAVLHHVYIHAHNTIAIFLEAVYEQTQVAPQHQEYLFEGHLCI
LEPSLSAQHIAHTTTSSPLTLLSTASETPKGLAFRDPAQDIPKFFPKVDLQSDYTTSKVR
GGAGGSNHKTPQISQKPARLSQRCHTPNVVVGLCLPIPQPCPFSVLPWRFSSVSGTPEIE
EVKRVTELKSRLRALAEALSRCSHRITETQLRLSNLSSELLKNRDQVHADRSIQKIQCCL
DKMNLIYKQFKKSKMRPGLGYNEEQIHKLDKVNFSRLAKRLLKVFQEKCVQKYQTSLVTH
GMWMREVHETRNHLRMVSCSMAAHNTEAQGVQESLSKILDRLSNQLLQDRAKEAQVSPSP
AAPYPSPALTDLVFHMQELCNEMKLLAFDLQDNNRIIEGLNTPPSGS
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgcagagcaccgtcaattacctgtggcacacggacgacctgctgggccagggcgccact
gccagcgtgtacaaggcccggaacaagaaatccggggagctggttgctgtgaaggtcttc
aacacggccagctacctgcgcccgcacgaggtgcaggtgagggagtttgaggtcctgcga
aagctgaaccaccagaacatcgtcaagctcttcgcggtggaggagacagggggcagccgg
cagaaggtgctggtgatggagtactgctctagtgggagcctgctgagcgtgctcgagagc
cccgagaatgccttcgggctgcccgaggaggagtttctggtggtgctgcgctgtgtggtg
gctggcatgaaccacctgcgggagaatggcatcgtccaccgcgacatcaagcctgggaat
atcatgcgtctcatgggggaggaggggcagagcatctacaagctcacggacttcggggcc
gcccgggagctagacgacgacgagaagtttgtctctgtctatggcactgaggagtacctg
caccccgacatgtatgagcgggctgtgcttcgcaagccccagcagaagacattcggggtg
actgtggatctctggagcattggggtcaccctgtaccacgccgccactggcagcctgccc
ttcatcccctttggtgggccacgacgcaacaaggagatgatgtaccggatcaccacggag
aagccggccggcgccatcgcaggcgctcagaggcgggagaacgggcccctggagtggagc
tacagcctccctgtcacctgccgcctgtccgtggggctgcagacccagctggtgcccatc
ctggccaacatcctggaggtggagcaggccaagtgctggggcttcgaccagttctttgcg
gagaccagcgacatcctgcagcgagtcgttgtgcacgtgttctccctgtcccaggccgtt
ttgcaccacgtctacatccacgcccacaacacgatagccatctttctggaggctgtgtat
gagcagacccaggtggccccccagcaccaggagtacctcttcgagggtcacctttgcatc
cttgagcccagcctgtcagcacaacacatcgcccacacgaccacaagcagccccctgacg
ctgttgagcacggccagtgagactcccaaggggctggccttcagggacccggctcaggac
atccccaagttcttccccaaagtggacctgcagtcagattacaccacctccaaggtgaga
ggcggtgcgggtggatccaaccacaaaactccccagatatcccagaagccagcaaggctg
tcccaaagatgtcatactcctaacgtggtcgtggggctctgcctcccaatcccccagccg
tgtcctttctctgtccttccctggaggttcagcagtgtgtctgggacgcctgagatagag
gaggtgaagagagtgaccgagctgaagtccaggctgcgggctttggcagaggccctctcc
agatgctcccacaggatcacagagacccagttgcgcctgagcaacctgagttctgagctg
ctgaagaaccgggatcaggtacatgcggacagaagcatccagaagattcagtgttgtttg
gacaagatgaacctcatctacaaacaattcaagaaatccaaaatgaggccagggcttggc
tacaatgaggagcagattcacaagctggataaggtgaattttagtcgtctagccaaaaga
cttctgaaggtattccaggagaagtgtgtgcagaagtaccagacatccctggtcactcac
ggcatgtggatgagggaggtgcacgagaccaggaaccatctgcgcatggtcagctgttcc
atggctgcccacaacacggaagcccagggagtccaggagagcctcagcaagatccttgac
cggttatctaaccagctccttcaggacagagcaaaggaggctcaggtctcaccatccccg
gcagccccctatcccagccctgcactgacggacctggttttccacatgcaagaactctgc
aatgagatgaagctgctggccttcgaccttcaggacaacaaccgcatcattgaagggtta
aatacgcccccatccggctcctga

DBGET integrated database retrieval system