KEGG   Ailuropoda melanoleuca (giant panda): 100465223
Entry
100465223         CDS       T01329                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04015  Rap1 signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04114  Oocyte meiosis
aml04218  Cellular senescence
aml04261  Adrenergic signaling in cardiomyocytes
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04611  Platelet activation
aml04613  Neutrophil extracellular trap formation
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04668  TNF signaling pathway
aml04670  Leukocyte transendothelial migration
aml04714  Thermogenesis
aml04722  Neurotrophin signaling pathway
aml04723  Retrograde endocannabinoid signaling
aml04728  Dopaminergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04912  GnRH signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04917  Prolactin signaling pathway
aml04926  Relaxin signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml05014  Amyotrophic lateral sclerosis
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05132  Salmonella infection
aml05133  Pertussis
aml05135  Yersinia infection
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05205  Proteoglycans in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100465223 (MAPK13)
   04015 Rap1 signaling pathway
    100465223 (MAPK13)
   04370 VEGF signaling pathway
    100465223 (MAPK13)
   04668 TNF signaling pathway
    100465223 (MAPK13)
   04068 FoxO signaling pathway
    100465223 (MAPK13)
   04071 Sphingolipid signaling pathway
    100465223 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100465223 (MAPK13)
   04218 Cellular senescence
    100465223 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100465223 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100465223 (MAPK13)
   04613 Neutrophil extracellular trap formation
    100465223 (MAPK13)
   04620 Toll-like receptor signaling pathway
    100465223 (MAPK13)
   04621 NOD-like receptor signaling pathway
    100465223 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    100465223 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    100465223 (MAPK13)
   04660 T cell receptor signaling pathway
    100465223 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    100465223 (MAPK13)
   04659 Th17 cell differentiation
    100465223 (MAPK13)
   04657 IL-17 signaling pathway
    100465223 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    100465223 (MAPK13)
   04670 Leukocyte transendothelial migration
    100465223 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100465223 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    100465223 (MAPK13)
   04917 Prolactin signaling pathway
    100465223 (MAPK13)
   04926 Relaxin signaling pathway
    100465223 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    100465223 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100465223 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    100465223 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    100465223 (MAPK13)
   04722 Neurotrophin signaling pathway
    100465223 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100465223 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100465223 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    100465223 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100465223 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100465223 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100465223 (MAPK13)
   05020 Prion disease
    100465223 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    100465223 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100465223 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100465223 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100465223 (MAPK13)
   05135 Yersinia infection
    100465223 (MAPK13)
   05133 Pertussis
    100465223 (MAPK13)
   05152 Tuberculosis
    100465223 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100465223 (MAPK13)
   05161 Hepatitis B
    100465223 (MAPK13)
   05171 Coronavirus disease - COVID-19
    100465223 (MAPK13)
   05163 Human cytomegalovirus infection
    100465223 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100465223 (MAPK13)
   05169 Epstein-Barr virus infection
    100465223 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100465223 (MAPK13)
   05140 Leishmaniasis
    100465223 (MAPK13)
   05142 Chagas disease
    100465223 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100465223 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100465223 (MAPK13)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100465223 (MAPK13)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100465223 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 APH Kdo Kinase-like DUF4023
Other DBs
NCBI-GeneID: 100465223
NCBI-ProteinID: XP_002914340
Ensembl: ENSAMEG00000000376
UniProt: G1L0N5
LinkDB
Position
5
AA seq 366 aa
MSFTRRKGFYKQDVNKTSWELPKTYVSPTHVGSGAYGAVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELRLLKHMQHENVIGLLDVFTPASSLRSFHDFYLVMPFMQTDLQKIMGM
EFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLSQILKVTG
VPGAEFVQKLNDKAAKSYIQALPQSPKKDFSQLFPRASPQAIDVLEKMLELDVDKRLTAS
QALAHPFFELFRDPEEETEAPQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcttcacccggagaaagggcttctacaagcaggacgtcaacaagaccagctgggag
ctgcccaagacctacgtgtccccgacgcacgtaggcagcggggcttatggcgccgtgtgc
tccgccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccggcccttc
cagtccgagatctttgccaagcgggcctaccgagagctgcggctgctgaagcacatgcag
catgagaacgtcatcgggctcctggatgtcttcaccccagcctcctccctgcgcagcttc
catgacttctacctggtgatgcccttcatgcagacggacctgcagaagatcatggggatg
gagttcagtgaggacaagatccagtacctggtgtatcagatgcttaaggggctcaagtac
atccactcagctggggtcgtccatagggacctaaagccgggcaacctggctgtgaacgag
gactgtgagctgaagatcttggatttcggcctggcccggcatgcggacgctgagatgacg
ggctacgtggtgacccgctggtaccgggcccccgaggtgatcctcagctggatgcattac
aaccagactgtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaag
actctgttcaaggggaaagattacctggaccagctgtcccagatcctgaaagtgaccggg
gtgccaggcgcagagtttgtgcagaagttgaacgacaaagcagctaaatcctacatccag
gccctgccacagagccccaagaaggatttctctcagctcttcccgcgtgccagcccccag
gccatagatgtgctggagaagatgctggagctggacgtggataagcgcctgacggcctcg
caggccctcgcgcaccccttctttgaactcttccgagacccggaggaggagacagaggcc
ccgcagccttttgatgattccctagaacatgagaaactcacagtggatgaatggaagcag
cacatctacaaggagatcgtgaacttcagccccattgcccggaaggactcacggcgccgg
agcggcatgaagcttcagtga

KEGG   Ailuropoda melanoleuca (giant panda): 100465476
Entry
100465476         CDS       T01329                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X3
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04015  Rap1 signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04114  Oocyte meiosis
aml04218  Cellular senescence
aml04261  Adrenergic signaling in cardiomyocytes
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04611  Platelet activation
aml04613  Neutrophil extracellular trap formation
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04668  TNF signaling pathway
aml04670  Leukocyte transendothelial migration
aml04714  Thermogenesis
aml04722  Neurotrophin signaling pathway
aml04723  Retrograde endocannabinoid signaling
aml04728  Dopaminergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04912  GnRH signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04917  Prolactin signaling pathway
aml04926  Relaxin signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml05014  Amyotrophic lateral sclerosis
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05132  Salmonella infection
aml05133  Pertussis
aml05135  Yersinia infection
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05205  Proteoglycans in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100465476 (MAPK14)
   04015 Rap1 signaling pathway
    100465476 (MAPK14)
   04370 VEGF signaling pathway
    100465476 (MAPK14)
   04668 TNF signaling pathway
    100465476 (MAPK14)
   04068 FoxO signaling pathway
    100465476 (MAPK14)
   04071 Sphingolipid signaling pathway
    100465476 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100465476 (MAPK14)
   04218 Cellular senescence
    100465476 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100465476 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100465476 (MAPK14)
   04613 Neutrophil extracellular trap formation
    100465476 (MAPK14)
   04620 Toll-like receptor signaling pathway
    100465476 (MAPK14)
   04621 NOD-like receptor signaling pathway
    100465476 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    100465476 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    100465476 (MAPK14)
   04660 T cell receptor signaling pathway
    100465476 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    100465476 (MAPK14)
   04659 Th17 cell differentiation
    100465476 (MAPK14)
   04657 IL-17 signaling pathway
    100465476 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    100465476 (MAPK14)
   04670 Leukocyte transendothelial migration
    100465476 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100465476 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    100465476 (MAPK14)
   04917 Prolactin signaling pathway
    100465476 (MAPK14)
   04926 Relaxin signaling pathway
    100465476 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    100465476 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100465476 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    100465476 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    100465476 (MAPK14)
   04722 Neurotrophin signaling pathway
    100465476 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100465476 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100465476 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    100465476 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100465476 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100465476 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100465476 (MAPK14)
   05020 Prion disease
    100465476 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    100465476 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100465476 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100465476 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100465476 (MAPK14)
   05135 Yersinia infection
    100465476 (MAPK14)
   05133 Pertussis
    100465476 (MAPK14)
   05152 Tuberculosis
    100465476 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100465476 (MAPK14)
   05161 Hepatitis B
    100465476 (MAPK14)
   05171 Coronavirus disease - COVID-19
    100465476 (MAPK14)
   05163 Human cytomegalovirus infection
    100465476 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100465476 (MAPK14)
   05169 Epstein-Barr virus infection
    100465476 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100465476 (MAPK14)
   05140 Leishmaniasis
    100465476 (MAPK14)
   05142 Chagas disease
    100465476 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100465476 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100465476 (MAPK14)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100465476 (MAPK14)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100465476 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 100465476
NCBI-ProteinID: XP_002914341
Ensembl: ENSAMEG00000000425
LinkDB
Position
5
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGADLLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPEDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaatctgtccccggtgggctccggtgcctatggctccgtgtgtgct
gcttttgacacaaaaactgggttacgtgtggcagtgaagaagctctccagaccatttcag
tccattattcatgccaaaaggacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggatgtttttacacctgcaaggtctctggaggaattcaac
gatgtgtatctggtgacccatctcatgggagcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttcctcatctaccagattctccgaggtctcaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagatcttggattttggactggcccgacatacagatgatgaaatgaca
ggctatgtggccaccaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgatcttttgaagaaaatctcctcagagtctgcaagaaattacattcag
tctttgacccagatgccgaaaatgaactttgcaaatgtatttattggtgccaatcccttg
gctgtcgacttgctggagaagatgcttgtattggactcagacaagagaattacggcagcc
caagccctcgcacacgcctactttgctcagtaccacgaccctgaggatgaaccagtggct
gatccttacgatcagtcctttgaaagcagggacctccttatagatgaatggaaaagcctg
acctacgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggaatcc
tga

KEGG   Ailuropoda melanoleuca (giant panda): 100480235
Entry
100480235         CDS       T01329                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04015  Rap1 signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04114  Oocyte meiosis
aml04218  Cellular senescence
aml04261  Adrenergic signaling in cardiomyocytes
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04611  Platelet activation
aml04613  Neutrophil extracellular trap formation
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04668  TNF signaling pathway
aml04670  Leukocyte transendothelial migration
aml04714  Thermogenesis
aml04722  Neurotrophin signaling pathway
aml04723  Retrograde endocannabinoid signaling
aml04728  Dopaminergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04912  GnRH signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04917  Prolactin signaling pathway
aml04926  Relaxin signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml05014  Amyotrophic lateral sclerosis
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05132  Salmonella infection
aml05133  Pertussis
aml05135  Yersinia infection
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05205  Proteoglycans in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100480235 (MAPK12)
   04015 Rap1 signaling pathway
    100480235 (MAPK12)
   04370 VEGF signaling pathway
    100480235 (MAPK12)
   04668 TNF signaling pathway
    100480235 (MAPK12)
   04068 FoxO signaling pathway
    100480235 (MAPK12)
   04071 Sphingolipid signaling pathway
    100480235 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100480235 (MAPK12)
   04218 Cellular senescence
    100480235 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100480235 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100480235 (MAPK12)
   04613 Neutrophil extracellular trap formation
    100480235 (MAPK12)
   04620 Toll-like receptor signaling pathway
    100480235 (MAPK12)
   04621 NOD-like receptor signaling pathway
    100480235 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    100480235 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    100480235 (MAPK12)
   04660 T cell receptor signaling pathway
    100480235 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    100480235 (MAPK12)
   04659 Th17 cell differentiation
    100480235 (MAPK12)
   04657 IL-17 signaling pathway
    100480235 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    100480235 (MAPK12)
   04670 Leukocyte transendothelial migration
    100480235 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100480235 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    100480235 (MAPK12)
   04917 Prolactin signaling pathway
    100480235 (MAPK12)
   04926 Relaxin signaling pathway
    100480235 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    100480235 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100480235 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    100480235 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    100480235 (MAPK12)
   04722 Neurotrophin signaling pathway
    100480235 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100480235 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100480235 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    100480235 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100480235 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100480235 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100480235 (MAPK12)
   05020 Prion disease
    100480235 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    100480235 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100480235 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100480235 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100480235 (MAPK12)
   05135 Yersinia infection
    100480235 (MAPK12)
   05133 Pertussis
    100480235 (MAPK12)
   05152 Tuberculosis
    100480235 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100480235 (MAPK12)
   05161 Hepatitis B
    100480235 (MAPK12)
   05171 Coronavirus disease - COVID-19
    100480235 (MAPK12)
   05163 Human cytomegalovirus infection
    100480235 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100480235 (MAPK12)
   05169 Epstein-Barr virus infection
    100480235 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100480235 (MAPK12)
   05140 Leishmaniasis
    100480235 (MAPK12)
   05142 Chagas disease
    100480235 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100480235 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100480235 (MAPK12)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100480235 (MAPK12)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100480235 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo UvrD_C Kinase-like
Other DBs
NCBI-GeneID: 100480235
NCBI-ProteinID: XP_034500157
Ensembl: ENSAMEG00000002456
LinkDB
Position
15
AA seq 367 aa
MSSPPPARRGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDVWSAGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPADFVQRLQSADAKNYMEGLPELEKKDFASILTNASPLAVNLLEKMLVLDAERRV
TAAEALTHPYFESLRDTEDEPKAQKYDESFDDMDRTLDEWKRVTYKEVLSFKPPLQLGTK
VSKETAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagctctccgccgcccgcccgcaggggcttctaccgccaggaggtgaccaagacggct
tgggaggtgcgcgccgtgtaccaggacctgcagcccgtgggctccggcgcctacggcgcg
gtgtgctcggccgtggacagccgcacgggcgccaaggtggccatcaagaagctgtaccgg
cccttccagtcggagctcttcgccaagcgcgcctaccgcgagctgcgcctgctcaagcac
atgcgccacgagaacgtcatcgggctgctggacgtgttcacgcctgatgaaaccctggat
gatttcacagacttttacctggtgatgccgttcatggggactgacctgggaaagctcatg
aagcacgagaaactgagcgaggaccgaatccagttccttgtctaccagatgctgaagggg
ctgaagtacatccacgctgctggcgtcatccacagggacctgaagcctggcaacctggcc
gtgaatgaggactgtgagctgaagattctggacttcggcctggcgaggcaggcagacagc
gaaatgactgggtatgtggtgacccggtggtatcgggcacccgaggtcatcttgaactgg
atgcgctacacacagacagtggacgtctggtcagcgggctgcatcatggcggagatgatc
acggggaagacgctgtttaagggcagtgaccacctggaccagctgaaggagatcatgaag
gtgacagggacgcctcccgctgactttgtgcagaggctgcagagtgcggacgcaaagaac
tacatggagggcctccccgagttggagaagaaggattttgcctccatcctgactaatgca
agccctctggctgtgaacctcctggagaaaatgctggtgctagatgcagagcggcgggtg
acggcggccgaggcgctgacccacccctactttgagtcactgcgcgacacggaggacgag
cccaaggcccagaagtacgatgagtccttcgatgatatggaccgcacgctggacgagtgg
aaacgtgtcacatataaagaagtgctcagcttcaagcctcccctgcagttggggaccaag
gtctccaaggagacggctctgtga

KEGG   Ailuropoda melanoleuca (giant panda): 100480483
Entry
100480483         CDS       T01329                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04015  Rap1 signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04114  Oocyte meiosis
aml04218  Cellular senescence
aml04261  Adrenergic signaling in cardiomyocytes
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04611  Platelet activation
aml04613  Neutrophil extracellular trap formation
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04668  TNF signaling pathway
aml04670  Leukocyte transendothelial migration
aml04714  Thermogenesis
aml04722  Neurotrophin signaling pathway
aml04723  Retrograde endocannabinoid signaling
aml04728  Dopaminergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04912  GnRH signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04917  Prolactin signaling pathway
aml04926  Relaxin signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml05014  Amyotrophic lateral sclerosis
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05132  Salmonella infection
aml05133  Pertussis
aml05135  Yersinia infection
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05205  Proteoglycans in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100480483 (MAPK11)
   04015 Rap1 signaling pathway
    100480483 (MAPK11)
   04370 VEGF signaling pathway
    100480483 (MAPK11)
   04668 TNF signaling pathway
    100480483 (MAPK11)
   04068 FoxO signaling pathway
    100480483 (MAPK11)
   04071 Sphingolipid signaling pathway
    100480483 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100480483 (MAPK11)
   04218 Cellular senescence
    100480483 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100480483 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100480483 (MAPK11)
   04613 Neutrophil extracellular trap formation
    100480483 (MAPK11)
   04620 Toll-like receptor signaling pathway
    100480483 (MAPK11)
   04621 NOD-like receptor signaling pathway
    100480483 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    100480483 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    100480483 (MAPK11)
   04660 T cell receptor signaling pathway
    100480483 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    100480483 (MAPK11)
   04659 Th17 cell differentiation
    100480483 (MAPK11)
   04657 IL-17 signaling pathway
    100480483 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    100480483 (MAPK11)
   04670 Leukocyte transendothelial migration
    100480483 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100480483 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    100480483 (MAPK11)
   04917 Prolactin signaling pathway
    100480483 (MAPK11)
   04926 Relaxin signaling pathway
    100480483 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    100480483 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100480483 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    100480483 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    100480483 (MAPK11)
   04722 Neurotrophin signaling pathway
    100480483 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100480483 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100480483 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    100480483 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100480483 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100480483 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100480483 (MAPK11)
   05020 Prion disease
    100480483 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    100480483 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100480483 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100480483 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100480483 (MAPK11)
   05135 Yersinia infection
    100480483 (MAPK11)
   05133 Pertussis
    100480483 (MAPK11)
   05152 Tuberculosis
    100480483 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100480483 (MAPK11)
   05161 Hepatitis B
    100480483 (MAPK11)
   05171 Coronavirus disease - COVID-19
    100480483 (MAPK11)
   05163 Human cytomegalovirus infection
    100480483 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100480483 (MAPK11)
   05169 Epstein-Barr virus infection
    100480483 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100480483 (MAPK11)
   05140 Leishmaniasis
    100480483 (MAPK11)
   05142 Chagas disease
    100480483 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100480483 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100480483 (MAPK11)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100480483 (MAPK11)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100480483 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 100480483
NCBI-ProteinID: XP_034499591
Ensembl: ENSAMEG00000002468
LinkDB
Position
15
AA seq 332 aa
GAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTP
ATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLK
PSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCI
MAELLQGKALFPGNDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLRS
IFHGANPLAVDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKER
TVEEWKELTYQEVLSFKPAELPQSAGGLDIEQ
NT seq 999 nt   +upstreamnt  +downstreamnt
ggcgcctacggctcggtctgctcggcctatgacgcgcggctgcgccagaaggtggcggtg
aagaagctgtcgcgacccttccagtcgctgatccacgcgcggaggacttaccgcgagcta
cggctgctcaagcacctgaagcacgagaacgtcattgggctgctggacgtgttcacgccc
gccacctccatcgaggacttcagcgaagtgtacctggtgaccaccctgatgggcgccgac
ctgaacaacatcgtcaagtgccaggcgctgagcgacgagcacgtccagttcctggtttac
cagttgcttcgcgggctgaagtacatccactccgcggggatcatccaccgggacctgaag
cccagcaacgtggctgtgaacgaggactgcgagcttaggatcctggactttgggctagcc
cgccaggctgatgaggagatgaccggctatgtggccactcgctggtaccgggcccccgag
atcatgctgaattggatgcactacaaccagacagtggacatctggtctgtaggctgcatc
atggctgagctgctccaaggaaaggccctctttccaggaaatgactacatcgaccagctg
aagcgaatcatggaagttgtgggcacacccagccctgaggttctagcaaagatatcctca
gaacacgcccggacatacatccagtccctgccccctatgccccagaaggacctcaggagc
atcttccatggagccaaccccctggctgtggacctcctgggaaggatgctggtgcttgac
agtgaccagagggtcagtgcggccgaggccctggcccatgcctacttcagccagtaccac
gaccccgaagatgagcctgaggccgagccctacgatgagagcgttgaggccaaggagcgt
acagtggaggagtggaaggagctcacctaccaggaggtcctcagcttcaagcctgcagag
ctgccgcagtcagccggcggcctggacattgagcagtga

DBGET integrated database retrieval system