KEGG   Ailuropoda melanoleuca (giant panda): 100465439
Entry
100465439         CDS       T01329                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist isoform X1
  KO
K04726  BH3 interacting domain death agonist
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01524  Platinum drug resistance
aml04071  Sphingolipid signaling pathway
aml04115  p53 signaling pathway
aml04210  Apoptosis
aml04215  Apoptosis - multiple species
aml04217  Necroptosis
aml04650  Natural killer cell mediated cytotoxicity
aml04932  Non-alcoholic fatty liver disease
aml05010  Alzheimer disease
aml05014  Amyotrophic lateral sclerosis
aml05022  Pathways of neurodegeneration - multiple diseases
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100465439 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100465439 (BID)
   04215 Apoptosis - multiple species
    100465439 (BID)
   04217 Necroptosis
    100465439 (BID)
   04115 p53 signaling pathway
    100465439 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100465439 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100465439 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100465439 (BID)
   05014 Amyotrophic lateral sclerosis
    100465439 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    100465439 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100465439 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100465439 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100465439 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100465439 (BID)
   05161 Hepatitis B
    100465439 (BID)
   05160 Hepatitis C
    100465439 (BID)
   05164 Influenza A
    100465439 (BID)
   05162 Measles
    100465439 (BID)
   05168 Herpes simplex virus 1 infection
    100465439 (BID)
   05163 Human cytomegalovirus infection
    100465439 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100465439 (BID)
   05169 Epstein-Barr virus infection
    100465439 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100465439 (BID)
SSDB
Motif
Pfam: BID Bcl-2
Other DBs
NCBI-GeneID: 100465439
NCBI-ProteinID: XP_011232491
LinkDB
Position
16
AA seq 195 aa
MDCKVSNGPGLQDEHITNLLVFGFLQNCSNSNFHKELEVLGHEVSMPAYLQEDYDDGLQT
DGNRCSYFLESGERDSQGQEEIIQDIARQLAQIGDDMDHSIHPGLMNNLAMQFMNVNLSE
EDRRKSLTAALEQVMQTYPMDMEEEKTMLILAMLLAKKVADHTPSLLRDVFRTTVNFINQ
NLFTYVRNLVRNEMD
NT seq 588 nt   +upstreamnt  +downstreamnt
atggattgtaaggtcagcaatggtccaggcctccaggatgagcacatcacaaacttgctg
gtgtttggcttcctccaaaactgctccaactctaatttccacaaagagttggaggtgttg
ggccacgaggtgtccatgccagcttacctccaggaggactacgacgatgggctgcagaca
gacggcaaccggtgcagctacttcctggaaagtggggagagagattctcagggtcaagaa
gaaatcatccaggatatcgccaggcagctcgcccaaataggggacgatatggatcacagc
atccacccaggactcatgaataacctggcaatgcagtttatgaatgtgaacctgtcggaa
gaagacagaaggaagtccctcaccgctgcgctggagcaggtcatgcagacttaccctatg
gacatggaggaggagaagaccatgctgatcttggccatgctcttggccaaaaaggtggcc
gatcacacaccatccttgctccgtgatgtctttcgcacaacagtgaactttattaaccag
aacctattcacctatgtgaggaacttagtcagaaatgagatggactga

DBGET integrated database retrieval system