KEGG   Ailuropoda melanoleuca (giant panda): 100465793
Entry
100465793         CDS       T01329                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04210  Apoptosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04218  Cellular senescence
aml04261  Adrenergic signaling in cardiomyocytes
aml04370  VEGF signaling pathway
aml04371  Apelin signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04611  Platelet activation
aml04613  Neutrophil extracellular trap formation
aml04620  Toll-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04668  TNF signaling pathway
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04728  Dopaminergic synapse
aml04910  Insulin signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04920  Adipocytokine signaling pathway
aml04922  Glucagon signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04926  Relaxin signaling pathway
aml04929  GnRH secretion
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml04973  Carbohydrate digestion and absorption
aml05010  Alzheimer disease
aml05017  Spinocerebellar ataxia
aml05132  Salmonella infection
aml05135  Yersinia infection
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100465793 (AKT1)
   04012 ErbB signaling pathway
    100465793 (AKT1)
   04014 Ras signaling pathway
    100465793 (AKT1)
   04015 Rap1 signaling pathway
    100465793 (AKT1)
   04370 VEGF signaling pathway
    100465793 (AKT1)
   04371 Apelin signaling pathway
    100465793 (AKT1)
   04630 JAK-STAT signaling pathway
    100465793 (AKT1)
   04668 TNF signaling pathway
    100465793 (AKT1)
   04066 HIF-1 signaling pathway
    100465793 (AKT1)
   04068 FoxO signaling pathway
    100465793 (AKT1)
   04072 Phospholipase D signaling pathway
    100465793 (AKT1)
   04071 Sphingolipid signaling pathway
    100465793 (AKT1)
   04024 cAMP signaling pathway
    100465793 (AKT1)
   04022 cGMP-PKG signaling pathway
    100465793 (AKT1)
   04151 PI3K-Akt signaling pathway
    100465793 (AKT1)
   04152 AMPK signaling pathway
    100465793 (AKT1)
   04150 mTOR signaling pathway
    100465793 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100465793 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    100465793 (AKT1)
   04218 Cellular senescence
    100465793 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100465793 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100465793 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100465793 (AKT1)
   04613 Neutrophil extracellular trap formation
    100465793 (AKT1)
   04620 Toll-like receptor signaling pathway
    100465793 (AKT1)
   04625 C-type lectin receptor signaling pathway
    100465793 (AKT1)
   04660 T cell receptor signaling pathway
    100465793 (AKT1)
   04662 B cell receptor signaling pathway
    100465793 (AKT1)
   04664 Fc epsilon RI signaling pathway
    100465793 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    100465793 (AKT1)
   04062 Chemokine signaling pathway
    100465793 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100465793 (AKT1)
   04922 Glucagon signaling pathway
    100465793 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    100465793 (AKT1)
   04920 Adipocytokine signaling pathway
    100465793 (AKT1)
   04929 GnRH secretion
    100465793 (AKT1)
   04915 Estrogen signaling pathway
    100465793 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    100465793 (AKT1)
   04917 Prolactin signaling pathway
    100465793 (AKT1)
   04926 Relaxin signaling pathway
    100465793 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    100465793 (AKT1)
   04919 Thyroid hormone signaling pathway
    100465793 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100465793 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100465793 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    100465793 (AKT1)
   04728 Dopaminergic synapse
    100465793 (AKT1)
   04722 Neurotrophin signaling pathway
    100465793 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100465793 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    100465793 (AKT1)
   04213 Longevity regulating pathway - multiple species
    100465793 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100465793 (AKT1)
   05205 Proteoglycans in cancer
    100465793 (AKT1)
   05230 Central carbon metabolism in cancer
    100465793 (AKT1)
   05231 Choline metabolism in cancer
    100465793 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100465793 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100465793 (AKT1)
   05212 Pancreatic cancer
    100465793 (AKT1)
   05225 Hepatocellular carcinoma
    100465793 (AKT1)
   05226 Gastric cancer
    100465793 (AKT1)
   05214 Glioma
    100465793 (AKT1)
   05221 Acute myeloid leukemia
    100465793 (AKT1)
   05220 Chronic myeloid leukemia
    100465793 (AKT1)
   05218 Melanoma
    100465793 (AKT1)
   05211 Renal cell carcinoma
    100465793 (AKT1)
   05215 Prostate cancer
    100465793 (AKT1)
   05213 Endometrial cancer
    100465793 (AKT1)
   05224 Breast cancer
    100465793 (AKT1)
   05222 Small cell lung cancer
    100465793 (AKT1)
   05223 Non-small cell lung cancer
    100465793 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100465793 (AKT1)
   05017 Spinocerebellar ataxia
    100465793 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100465793 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100465793 (AKT1)
   04931 Insulin resistance
    100465793 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100465793 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100465793 (AKT1)
   05135 Yersinia infection
    100465793 (AKT1)
   05152 Tuberculosis
    100465793 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100465793 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    100465793 (AKT1)
   05161 Hepatitis B
    100465793 (AKT1)
   05160 Hepatitis C
    100465793 (AKT1)
   05164 Influenza A
    100465793 (AKT1)
   05162 Measles
    100465793 (AKT1)
   05168 Herpes simplex virus 1 infection
    100465793 (AKT1)
   05163 Human cytomegalovirus infection
    100465793 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100465793 (AKT1)
   05169 Epstein-Barr virus infection
    100465793 (AKT1)
   05165 Human papillomavirus infection
    100465793 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100465793 (AKT1)
   05142 Chagas disease
    100465793 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100465793 (AKT1)
   01524 Platinum drug resistance
    100465793 (AKT1)
   01522 Endocrine resistance
    100465793 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100465793 (AKT1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100465793 (AKT1)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100465793 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100465793
NCBI-ProteinID: XP_034497893
Ensembl: ENSAMEG00000007766
LinkDB
Position
14
AA seq 482 aa
MTRWKQVPRPLTARVSAGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRESPLNNFSVA
QCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEEMM
DFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAM
KILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFH
LSRERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKE
GIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMLCGRLPFYNQDHEKLF
ELILMEELRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSDDAKEIMQHRFFASVVWQDVYE
KKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQGDNMEGEDSERRPHFPQFSYSASG
TA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgacgaggtggaagcaggtgccgcggcccctcactgcccgcgtgtctgcaggggagtac
atcaaaacctggcggccccgctactttctcctcaagaatgacggcaccttcatcggctac
aaggagcggccccaggatgtcgagcagcgagagtcccctctcaacaacttctctgtggct
caatgccagctgatgaagacagagcggccccggcccaacaccttcatcatccgctgcctg
cagtggaccacggtgatcgagcgcaccttccacgtggagacacccgaggagcgggaggag
tggacaactgccatccagacggtggccgacgggctcaagaggcaggaggaagagatgatg
gacttccggtcggggtcgccgagcgacaactccggcgccgaggagatggaggtgtccctg
gccaagcccaagcaccgtgtgaccatgaacgagttcgagtacttgaagctgctgggcaag
ggtacgtttgggaaagtgatcctggtgaaggagaaggccacgggccgctactacgccatg
aagatcctgaagaaggaggtcattgtggccaaggatgaggttgcccacacgctcacggag
aaccgcgttctgcagaactcgcggcatcccttcctgacggccctgaagtactcctttcag
acccacgaccgtctctgcttcgtcatggagtacgccaacgggggtgagctcttcttccac
ctgtcccgggagcgcgtgttccccgaggaccgggcccgcttctacggtgccgagatcgtg
tctgccttggactacctgcactcggagaagaacgtggtctaccgtgacctcaagctggag
aacctcatgctggataaggatgggcacatcaagatcactgacttcggcctgtgcaaggag
ggcatcaaggacggggccaccatgaagaccttctgcgggacgcccgagtacctggccccc
gaggtgctggaggacaacgactatggccgggcggtggactggtgggggctgggcgtggtc
atgtacgagatgctatgcggccggctgcccttctacaaccaggaccacgagaagctcttc
gagctcatcctcatggaggagctccgcttcccgcgcacgctcagccccgaggccaagtcc
ctgctctcggggctgctcaagaaggaccccaagcagaggctcggagggggctcggacgac
gccaaggagatcatgcagcaccgcttcttcgccagcgtcgtgtggcaggatgtgtacgag
aagaagctcagtccacccttcaagccccaggtcacatcagagacagacaccaggtatttt
gatgaggagttcacggctcagatgatcaccatcacgccacccgaccaaggtgacaacatg
gagggtgaggacagcgagcggaggccccacttcccgcagttctcctactcggccagcggc
acagcctga

KEGG   Ailuropoda melanoleuca (giant panda): 100468763
Entry
100468763         CDS       T01329                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04210  Apoptosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04218  Cellular senescence
aml04261  Adrenergic signaling in cardiomyocytes
aml04370  VEGF signaling pathway
aml04371  Apelin signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04611  Platelet activation
aml04613  Neutrophil extracellular trap formation
aml04620  Toll-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04668  TNF signaling pathway
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04728  Dopaminergic synapse
aml04910  Insulin signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04920  Adipocytokine signaling pathway
aml04922  Glucagon signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04926  Relaxin signaling pathway
aml04929  GnRH secretion
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml04973  Carbohydrate digestion and absorption
aml05010  Alzheimer disease
aml05017  Spinocerebellar ataxia
aml05132  Salmonella infection
aml05135  Yersinia infection
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100468763 (AKT2)
   04012 ErbB signaling pathway
    100468763 (AKT2)
   04014 Ras signaling pathway
    100468763 (AKT2)
   04015 Rap1 signaling pathway
    100468763 (AKT2)
   04370 VEGF signaling pathway
    100468763 (AKT2)
   04371 Apelin signaling pathway
    100468763 (AKT2)
   04630 JAK-STAT signaling pathway
    100468763 (AKT2)
   04668 TNF signaling pathway
    100468763 (AKT2)
   04066 HIF-1 signaling pathway
    100468763 (AKT2)
   04068 FoxO signaling pathway
    100468763 (AKT2)
   04072 Phospholipase D signaling pathway
    100468763 (AKT2)
   04071 Sphingolipid signaling pathway
    100468763 (AKT2)
   04024 cAMP signaling pathway
    100468763 (AKT2)
   04022 cGMP-PKG signaling pathway
    100468763 (AKT2)
   04151 PI3K-Akt signaling pathway
    100468763 (AKT2)
   04152 AMPK signaling pathway
    100468763 (AKT2)
   04150 mTOR signaling pathway
    100468763 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100468763 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    100468763 (AKT2)
   04218 Cellular senescence
    100468763 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100468763 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100468763 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100468763 (AKT2)
   04613 Neutrophil extracellular trap formation
    100468763 (AKT2)
   04620 Toll-like receptor signaling pathway
    100468763 (AKT2)
   04625 C-type lectin receptor signaling pathway
    100468763 (AKT2)
   04660 T cell receptor signaling pathway
    100468763 (AKT2)
   04662 B cell receptor signaling pathway
    100468763 (AKT2)
   04664 Fc epsilon RI signaling pathway
    100468763 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    100468763 (AKT2)
   04062 Chemokine signaling pathway
    100468763 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100468763 (AKT2)
   04922 Glucagon signaling pathway
    100468763 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    100468763 (AKT2)
   04920 Adipocytokine signaling pathway
    100468763 (AKT2)
   04929 GnRH secretion
    100468763 (AKT2)
   04915 Estrogen signaling pathway
    100468763 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    100468763 (AKT2)
   04917 Prolactin signaling pathway
    100468763 (AKT2)
   04926 Relaxin signaling pathway
    100468763 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    100468763 (AKT2)
   04919 Thyroid hormone signaling pathway
    100468763 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100468763 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100468763 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    100468763 (AKT2)
   04728 Dopaminergic synapse
    100468763 (AKT2)
   04722 Neurotrophin signaling pathway
    100468763 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100468763 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    100468763 (AKT2)
   04213 Longevity regulating pathway - multiple species
    100468763 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100468763 (AKT2)
   05205 Proteoglycans in cancer
    100468763 (AKT2)
   05230 Central carbon metabolism in cancer
    100468763 (AKT2)
   05231 Choline metabolism in cancer
    100468763 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100468763 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100468763 (AKT2)
   05212 Pancreatic cancer
    100468763 (AKT2)
   05225 Hepatocellular carcinoma
    100468763 (AKT2)
   05226 Gastric cancer
    100468763 (AKT2)
   05214 Glioma
    100468763 (AKT2)
   05221 Acute myeloid leukemia
    100468763 (AKT2)
   05220 Chronic myeloid leukemia
    100468763 (AKT2)
   05218 Melanoma
    100468763 (AKT2)
   05211 Renal cell carcinoma
    100468763 (AKT2)
   05215 Prostate cancer
    100468763 (AKT2)
   05213 Endometrial cancer
    100468763 (AKT2)
   05224 Breast cancer
    100468763 (AKT2)
   05222 Small cell lung cancer
    100468763 (AKT2)
   05223 Non-small cell lung cancer
    100468763 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100468763 (AKT2)
   05017 Spinocerebellar ataxia
    100468763 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100468763 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100468763 (AKT2)
   04931 Insulin resistance
    100468763 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100468763 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100468763 (AKT2)
   05135 Yersinia infection
    100468763 (AKT2)
   05152 Tuberculosis
    100468763 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100468763 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    100468763 (AKT2)
   05161 Hepatitis B
    100468763 (AKT2)
   05160 Hepatitis C
    100468763 (AKT2)
   05164 Influenza A
    100468763 (AKT2)
   05162 Measles
    100468763 (AKT2)
   05168 Herpes simplex virus 1 infection
    100468763 (AKT2)
   05163 Human cytomegalovirus infection
    100468763 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100468763 (AKT2)
   05169 Epstein-Barr virus infection
    100468763 (AKT2)
   05165 Human papillomavirus infection
    100468763 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100468763 (AKT2)
   05142 Chagas disease
    100468763 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100468763 (AKT2)
   01524 Platinum drug resistance
    100468763 (AKT2)
   01522 Endocrine resistance
    100468763 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100468763 (AKT2)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100468763 (AKT2)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100468763 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 100468763
NCBI-ProteinID: XP_034494337
Ensembl: ENSAMEG00000012536
LinkDB
Position
12
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPDAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDPSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAREVMEHRFFLSVNWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgttatcaaggaaggctggctccacaagcgtggtgaatacatcaag
acctggaggccccggtacttcctgttgaagagtgatggctccttcattggatacaaggag
cggcctgacgcccctgaccagaccttgccccccttgaacaacttctctgtcgcagaatgc
cagctgatgaagaccgagagaccacggcccaacacctttgtcatacgctgcctgcagtgg
accacggtcatcgagaggaccttccacgtagactctccagatgagagggaggagtggatg
cgggccattcagatggtcgccaacagcctcaagcagcggggcccaggtgaggaccccatg
gactataagtgtggctcccccagcgacccttctgcagccgaggagatggaagtggcagtt
agcaaggctcgggccaaggtgaccatgaatgacttcgactatctcaaacttctgggcaag
ggcacctttggtaaagtgattctggtgcgggagaaggccagcggccgctactacgccatg
aagatcctgcggaaggaagttatcatcgccaaggatgaagtcgcccacacggtcaccgag
agccgggtcctccagaacaccaggcacccattcctcactgcactgaagtacgccttccag
acccacgaccgcctgtgctttgtgatggagtatgccaacggtggtgagctgtttttccac
ctgtcccgggagcgcgtcttcacggaggagcgggctcgcttctacggtgcagagatagtc
tctgccctcgagtatttgcactcgcgggacgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcactgacttcggcctatgcaaagagggc
atcagtgacggggccaccatgaaaaccttctgtgggacacccgagtacctggcacccgag
gtgctggaggacaacgactacggccgcgcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccgcgcacgctcagccccgaggccaagtccctg
cttgctgggctgcttaagaaggaccccaagcagaggctcggcggggggcccagcgatgcc
agggaggtcatggagcacaggttcttcctcagcgtcaactggcaggacgtggtacagaaa
aagcttctgccccccttcaaacctcaggtcacctccgaggttgacacaaggtactttgat
gatgagtttactgcccagtccatcacaatcacgcccccggaccgctatgacagcctgggc
tccctcgaactggaccagcggacccacttcccccagttctcctactcggccagcatccgc
gagtga

KEGG   Ailuropoda melanoleuca (giant panda): 100480414
Entry
100480414         CDS       T01329                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04210  Apoptosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04218  Cellular senescence
aml04261  Adrenergic signaling in cardiomyocytes
aml04370  VEGF signaling pathway
aml04371  Apelin signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04611  Platelet activation
aml04613  Neutrophil extracellular trap formation
aml04620  Toll-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04668  TNF signaling pathway
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04728  Dopaminergic synapse
aml04910  Insulin signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04920  Adipocytokine signaling pathway
aml04922  Glucagon signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04926  Relaxin signaling pathway
aml04929  GnRH secretion
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml04973  Carbohydrate digestion and absorption
aml05010  Alzheimer disease
aml05017  Spinocerebellar ataxia
aml05132  Salmonella infection
aml05135  Yersinia infection
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100480414 (AKT3)
   04012 ErbB signaling pathway
    100480414 (AKT3)
   04014 Ras signaling pathway
    100480414 (AKT3)
   04015 Rap1 signaling pathway
    100480414 (AKT3)
   04370 VEGF signaling pathway
    100480414 (AKT3)
   04371 Apelin signaling pathway
    100480414 (AKT3)
   04630 JAK-STAT signaling pathway
    100480414 (AKT3)
   04668 TNF signaling pathway
    100480414 (AKT3)
   04066 HIF-1 signaling pathway
    100480414 (AKT3)
   04068 FoxO signaling pathway
    100480414 (AKT3)
   04072 Phospholipase D signaling pathway
    100480414 (AKT3)
   04071 Sphingolipid signaling pathway
    100480414 (AKT3)
   04024 cAMP signaling pathway
    100480414 (AKT3)
   04022 cGMP-PKG signaling pathway
    100480414 (AKT3)
   04151 PI3K-Akt signaling pathway
    100480414 (AKT3)
   04152 AMPK signaling pathway
    100480414 (AKT3)
   04150 mTOR signaling pathway
    100480414 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100480414 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    100480414 (AKT3)
   04218 Cellular senescence
    100480414 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100480414 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100480414 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100480414 (AKT3)
   04613 Neutrophil extracellular trap formation
    100480414 (AKT3)
   04620 Toll-like receptor signaling pathway
    100480414 (AKT3)
   04625 C-type lectin receptor signaling pathway
    100480414 (AKT3)
   04660 T cell receptor signaling pathway
    100480414 (AKT3)
   04662 B cell receptor signaling pathway
    100480414 (AKT3)
   04664 Fc epsilon RI signaling pathway
    100480414 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    100480414 (AKT3)
   04062 Chemokine signaling pathway
    100480414 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100480414 (AKT3)
   04922 Glucagon signaling pathway
    100480414 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    100480414 (AKT3)
   04920 Adipocytokine signaling pathway
    100480414 (AKT3)
   04929 GnRH secretion
    100480414 (AKT3)
   04915 Estrogen signaling pathway
    100480414 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    100480414 (AKT3)
   04917 Prolactin signaling pathway
    100480414 (AKT3)
   04926 Relaxin signaling pathway
    100480414 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    100480414 (AKT3)
   04919 Thyroid hormone signaling pathway
    100480414 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100480414 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100480414 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    100480414 (AKT3)
   04728 Dopaminergic synapse
    100480414 (AKT3)
   04722 Neurotrophin signaling pathway
    100480414 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100480414 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    100480414 (AKT3)
   04213 Longevity regulating pathway - multiple species
    100480414 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100480414 (AKT3)
   05205 Proteoglycans in cancer
    100480414 (AKT3)
   05230 Central carbon metabolism in cancer
    100480414 (AKT3)
   05231 Choline metabolism in cancer
    100480414 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100480414 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100480414 (AKT3)
   05212 Pancreatic cancer
    100480414 (AKT3)
   05225 Hepatocellular carcinoma
    100480414 (AKT3)
   05226 Gastric cancer
    100480414 (AKT3)
   05214 Glioma
    100480414 (AKT3)
   05221 Acute myeloid leukemia
    100480414 (AKT3)
   05220 Chronic myeloid leukemia
    100480414 (AKT3)
   05218 Melanoma
    100480414 (AKT3)
   05211 Renal cell carcinoma
    100480414 (AKT3)
   05215 Prostate cancer
    100480414 (AKT3)
   05213 Endometrial cancer
    100480414 (AKT3)
   05224 Breast cancer
    100480414 (AKT3)
   05222 Small cell lung cancer
    100480414 (AKT3)
   05223 Non-small cell lung cancer
    100480414 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100480414 (AKT3)
   05017 Spinocerebellar ataxia
    100480414 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100480414 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100480414 (AKT3)
   04931 Insulin resistance
    100480414 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100480414 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100480414 (AKT3)
   05135 Yersinia infection
    100480414 (AKT3)
   05152 Tuberculosis
    100480414 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100480414 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    100480414 (AKT3)
   05161 Hepatitis B
    100480414 (AKT3)
   05160 Hepatitis C
    100480414 (AKT3)
   05164 Influenza A
    100480414 (AKT3)
   05162 Measles
    100480414 (AKT3)
   05168 Herpes simplex virus 1 infection
    100480414 (AKT3)
   05163 Human cytomegalovirus infection
    100480414 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100480414 (AKT3)
   05169 Epstein-Barr virus infection
    100480414 (AKT3)
   05165 Human papillomavirus infection
    100480414 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100480414 (AKT3)
   05142 Chagas disease
    100480414 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100480414 (AKT3)
   01524 Platinum drug resistance
    100480414 (AKT3)
   01522 Endocrine resistance
    100480414 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100480414 (AKT3)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100480414 (AKT3)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100480414 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 100480414
NCBI-ProteinID: XP_011221869
Ensembl: ENSAMEG00000009273
UniProt: G1LRV9
LinkDB
Position
8
AA seq 479 aa
MSDVTVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCVDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccgtcgtgaaagaaggctgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
actgttatagagagaacgtttcatgtagatacaccagaggaaagggaagagtggacagaa
gctattcaggctgtagcagacagacttcagagacaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggggaagaagagatggatgcttccacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactgctaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtgggaaatactatgctatgaagattctgaag
aaagaagttattattgcaaaggatgaagtggcacatactctaactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgtaaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctccgaggaccgcacacgtttctatggtgcagaaattgtctctgctttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaatcacggactttgggctttgcaaagaagggatcacggacgcg
gccaccatgaagacgttctgtggcacaccggagtacctggcacccgaggtattagaagac
aacgactatggccgagccgtggattggtggggcctgggggtcgtcatgtatgagatgatg
tgtgggaggctacctttctacaaccaggatcatgagaaactttttgaactaatactaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcactgctttcagggctc
ttgataaaggatccaaataagcgccttggcgggggcccagatgatgcaaaagaaattatg
aggcacagtttcttctctggagtcaactggcaagatgtatacgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagataccaggtattttgatgaagaatttaca
gctcagactattacaataacgccacctgaaaaatatgacgaggacggcatggactgcgtg
gacaacgagcggcggccgcacttccctcagttctcctactccgccagtggccgcgagtaa

DBGET integrated database retrieval system