KEGG   Ailuropoda melanoleuca (giant panda): 100465982
Entry
100465982         CDS       T01329                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X2
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04520  Adherens junction
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05132  Salmonella infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05213  Endometrial cancer
aml05215  Prostate cancer
aml05216  Thyroid cancer
aml05217  Basal cell carcinoma
aml05221  Acute myeloid leukemia
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100465982 (LEF1)
   04390 Hippo signaling pathway
    100465982 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100465982 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100465982 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100465982 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100465982 (LEF1)
   05225 Hepatocellular carcinoma
    100465982 (LEF1)
   05226 Gastric cancer
    100465982 (LEF1)
   05216 Thyroid cancer
    100465982 (LEF1)
   05221 Acute myeloid leukemia
    100465982 (LEF1)
   05217 Basal cell carcinoma
    100465982 (LEF1)
   05215 Prostate cancer
    100465982 (LEF1)
   05213 Endometrial cancer
    100465982 (LEF1)
   05224 Breast cancer
    100465982 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100465982 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100465982 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100465982 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100465982 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100465982 (LEF1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100465982 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100465982
NCBI-ProteinID: XP_002916983
Ensembl: ENSAMEG00000001768
UniProt: G1L4U0
LinkDB
Position
11
AA seq 399 aa
MPQLSGAGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQESYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHLPSDVNS
KQGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgccccaactctccggggccggcggcggcggtgggggagacccggaactctgcgccacc
gacgagatgatccccttcaaagatgagggcgatcctcagaaggagaaaatcttcgcagaa
atcagtcaccctgaagaggaaggcgacttagccgacatcaagtcttccttggttaacgag
tctgaaatcatcccggccagcaacggacacgaggtggccagacaagcacaaacctcccag
gagtcctaccacgacaaggccagagaacaccctgatgacggaaagcatccagatggcggc
ctctacaataagggaccctcctactcgagttattccgggtacataatgatgccaaatatg
aataatgacccatacatgtcaaatggatctctctctccacccatcccaagaacatcaaat
aaggtgcccgtggtgcagccatcgcatgcagtccatcctctcacccccctcatcacgtac
agcgacgagcacttttctccaggatcacatccctcacacctcccatcagatgtcaactcc
aaacaaggcatgtccagacatcctccagctcctgagatccccaccttttatcccctgtct
ccaggtggtgttggacagattaccccacctcttggctggcaaggtcagcctgtctatccc
atcacgggaggattcaggcaaccctatccatcctcactgtcagtcgacacttccatgtcc
aggttttcccatcatatgattcctggtcctcctggtccccacacaactggcatccctcat
ccagctatcgtaacgcctcaggtcaaacaggagcacccccacactgacagtgacctaatg
cacgtgaagcctcagcatgaacagagaaaggaacaggagccaaaaagacctcacattaag
aagcctctgaatgcttttatgttatacatgaaagaaatgagagcgaatgtcgtagctgag
tgtactttaaaagaaagtgcagctatcaaccagattctaggcagaaggtggcatgccctc
tcccgtgaagagcaggcaaaatactacgaattagcccggaaggaaagacagctacatatg
cagctctacccaggctggtcggcaagagacaattacggtaagaagaagaagaggaagaga
gagaaactccaggagtcgacatcaggtacaggtccaagaatgacagctgcctacatctga

KEGG   Ailuropoda melanoleuca (giant panda): 100467719
Entry
100467719         CDS       T01329                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X6
  KO
K04491  transcription factor 7-like 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04520  Adherens junction
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05132  Salmonella infection
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05213  Endometrial cancer
aml05215  Prostate cancer
aml05216  Thyroid cancer
aml05217  Basal cell carcinoma
aml05221  Acute myeloid leukemia
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100467719 (TCF7L2)
   04390 Hippo signaling pathway
    100467719 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100467719 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100467719 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100467719 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100467719 (TCF7L2)
   05225 Hepatocellular carcinoma
    100467719 (TCF7L2)
   05226 Gastric cancer
    100467719 (TCF7L2)
   05216 Thyroid cancer
    100467719 (TCF7L2)
   05221 Acute myeloid leukemia
    100467719 (TCF7L2)
   05217 Basal cell carcinoma
    100467719 (TCF7L2)
   05215 Prostate cancer
    100467719 (TCF7L2)
   05213 Endometrial cancer
    100467719 (TCF7L2)
   05224 Breast cancer
    100467719 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100467719 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100467719 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100467719 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100467719 (TCF7L2)
   05165 Human papillomavirus infection
    100467719 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100467719 (TCF7L2)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100467719 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100467719
NCBI-ProteinID: XP_011230155
Ensembl: ENSAMEG00000015382
LinkDB
Position
6
AA seq 556 aa
MKLLLTDWNAYLSLVLLRLCSVLSIWVKGWWRSHLLTCSASSRQRKTTLYLQMKWPLLDV
QAGTLQSRQALKDARSPSPAHIVQCPLPCCTQGHDCQHFYPPSDFTVSTQVFRDMKRSHS
LHKVGEPWCLESNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRP
PHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSSF
LSSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKP
HIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQ
LHMQLYPGWSARDNYGKKKKRKRDKQPGETNDANTPKKCRALFGLDRQTLWCKPCRRKKK
CVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPQDAKSQTEQTQPLSLSLKPDPLAH
LSMMPPPPALLLAEAAHGKAPALCPNGALDLPPAALQPPVMSSSSLAQPSTSSLHSHSAL
AGTQPQPLSLVTKSLE
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgaaactcttacttactgactggaatgcgtatctatcactggtacttttgagactctgc
tctgttctctccatctgggtcaaaggctggtggagaagccaccttctcacgtgctctgcg
tcatctcggcagaggaaaaccacactgtatctccaaatgaaatggccactgcttgatgtc
caggcggggaccctccagagcagacaagccctcaaggatgcccgctctccgtcgccggca
cacattgtccagtgccccctcccttgctgcactcagggacatgactgtcagcacttctac
cccccctcagacttcactgtcagcactcaagtcttcagggacatgaaaaggagccactcc
ttacacaaggttggggagccctggtgtttggagtcgaacaaagtgccagtcgtgcagcac
cctcaccatgttcaccctctcacgccgctcatcacgtacagcaatgagcacttcaccccg
ggaaacccacctccacacttaccagctgacgtagaccccaaaacaggaatcccacggcct
ccgcaccctccagatatatctccgtattacccgctatcgcccggcaccgtaggacaaatc
ccccatccgctaggatggttagtaccacagcaaggtcagccagtgtacccaatcacgaca
ggaggattccgtcacccgtaccccacagctctgaccgtcaacgcttccatgtccagcttc
ctgtcttccaggttccctccccatatggtcccaccacatcacactctacatacgaccggc
atcccccacccggccatagtcacgccaacagtcaaacaggaatcctcccagagtgacgtc
ggctcactccatagctcaaagcatcaggactccaaaaaggaagaagaaaagaagaagccc
cacataaagaaacctcttaacgcattcatgttgtatatgaaggaaatgagggcaaaggtc
gtggccgagtgcacgttgaaagaaagcgcggccatcaaccagatcctggggcgaaggtgg
cacgcactgtccagagaggagcaagcgaagtactacgagctggcccggaaggagcgacag
cttcacatgcagctgtaccccggctggtctgcgcgggacaactacgggaagaagaagaag
aggaaaagggacaagcagcccggagagaccaatgatgcaaatactccaaagaagtgtcgg
gcactgttcgggcttgaccgacagactttatggtgcaaaccgtgcaggagaaaaaaaaag
tgcgttcgctacatacaaggtgaaggcagctgcctcagtccaccctcttcagatggaagc
ttactagactcgcctcctccctcccccaacctgctaggctcccctccccaagacgccaag
tcacagactgagcagacccagcctctctcgctgtccctgaagcccgatcccctggcccac
ctgtccatgatgcctccgccgcccgccctcctgcttgccgaggccgcccacggcaaggcc
cccgccctctgtcccaacggggccctggacctgcctcccgccgctttgcagccgcccgtc
atgtcctcctcctctcttgcacagccgtcaacatcttccttacattcccacagcgctctg
gccgggacccagccccagccgctgtccctcgtgaccaagtctttagaatag

KEGG   Ailuropoda melanoleuca (giant panda): 100476528
Entry
100476528         CDS       T01329                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 isoform X2
  KO
K02620  transcription factor 7
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04520  Adherens junction
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05132  Salmonella infection
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05213  Endometrial cancer
aml05215  Prostate cancer
aml05216  Thyroid cancer
aml05217  Basal cell carcinoma
aml05221  Acute myeloid leukemia
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100476528 (TCF7)
   04390 Hippo signaling pathway
    100476528 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100476528 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    100476528 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100476528 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100476528 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100476528 (TCF7)
   05225 Hepatocellular carcinoma
    100476528 (TCF7)
   05226 Gastric cancer
    100476528 (TCF7)
   05216 Thyroid cancer
    100476528 (TCF7)
   05221 Acute myeloid leukemia
    100476528 (TCF7)
   05217 Basal cell carcinoma
    100476528 (TCF7)
   05215 Prostate cancer
    100476528 (TCF7)
   05213 Endometrial cancer
    100476528 (TCF7)
   05224 Breast cancer
    100476528 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100476528 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100476528 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100476528 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100476528 (TCF7)
   05165 Human papillomavirus infection
    100476528 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100476528 (TCF7)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100476528 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100476528
NCBI-ProteinID: XP_011222641
Ensembl: ENSAMEG00000017798
LinkDB
Position
3
AA seq 303 aa
MYKDTVYSAFNLLMHYPPPSGAGQHPQPQPPLHNKASQPAHSVPQLSPLYEHFSSPHPTP
APADISQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPA
PTAAPGAPYPRFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPYDRSLKTQAESKVE
KEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYEL
ARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESSTGGKRNAFGTYPEKAAAPAPFLPM
TVL
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtacaaagacaccgtctactccgccttcaatctgctcatgcactacccgcccccgtcg
ggagcagggcagcacccccagccgcagcccccgctgcacaacaaggccagtcagccagcc
cacagcgtcccacaactctctcctctctatgaacatttcagcagcccacaccctacacct
gcaccagccgacatcagccagaaacaaggagttcacaggccactgcagacccctgacctc
tctggcttctactctctgacctcaggcagcatgggacaactcccccacactgtgagctgg
cccagccctcctctctaccccttgtccccttcctgcggatatagacagcacttccctgcc
cccactgcagcccctggcgccccctaccccaggttcacccacccatccctgatgctaggc
tctggtgtacctggtcaccctgcagccatcccccacccagccatcgtacctccctcaggg
aagcaggagctgcagccgtatgaccgtagcctgaagacgcaggcagaatccaaggtagag
aaggaggccaagaagccaaccatcaagaagcccctcaacgccttcatgctgtacatgaag
gagatgagagccaaggtcatagcagagtgcacgctcaaggagagtgctgccatcaaccag
atcctgggccgaaggtggcatgcgctgtctcgggaagagcaagccaagtattatgagctg
gcccgaaaggagagacagctgcatatgcaactgtacccaggctggtcggcgcgggacaat
tatgggaagaagaaaaggcgatctcgggaaaagcaccaggaatccagcacaggaggaaaa
agaaatgcattcggtacttacccggagaaggccgctgccccagccccgttccttccgatg
acagtgctctag

KEGG   Ailuropoda melanoleuca (giant panda): 100480690
Entry
100480690         CDS       T01329                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04520  Adherens junction
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05132  Salmonella infection
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05213  Endometrial cancer
aml05215  Prostate cancer
aml05216  Thyroid cancer
aml05217  Basal cell carcinoma
aml05221  Acute myeloid leukemia
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100480690 (TCF7L1)
   04390 Hippo signaling pathway
    100480690 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100480690 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100480690 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100480690 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100480690 (TCF7L1)
   05225 Hepatocellular carcinoma
    100480690 (TCF7L1)
   05226 Gastric cancer
    100480690 (TCF7L1)
   05216 Thyroid cancer
    100480690 (TCF7L1)
   05221 Acute myeloid leukemia
    100480690 (TCF7L1)
   05217 Basal cell carcinoma
    100480690 (TCF7L1)
   05215 Prostate cancer
    100480690 (TCF7L1)
   05213 Endometrial cancer
    100480690 (TCF7L1)
   05224 Breast cancer
    100480690 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100480690 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100480690 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100480690 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100480690 (TCF7L1)
   05165 Human papillomavirus infection
    100480690 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100480690 (TCF7L1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100480690 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100480690
NCBI-ProteinID: XP_034515345
LinkDB
Position
4
AA seq 554 aa
HDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLVNESENQSSSSDSEAERRPQPARDA
FQKPRDYFTEVRRPQDGAFFKGPPYPGYPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWP
LLDVPSSATVKDTRSPSPAHLSNKVPVVQPPHHMHPLTPLITYSNDHFSPGSPPTHLSPE
IDPKTGIPRPPHPSELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPAL
AMNASMSSLVSSRFSPHMVAPAHPGLPASGIPHPAIVSPIVKQEPAPPSLSPAVSAKSPV
TVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQAK
YYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAEGALASKSKKP
CVQYLPPEKSCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPESRAQ
LALHSAAFLSAKATATSSGQMGSQPPLLSRPLPLGSLPTALLTSPPSFPAALHAHQALPV
LQAQPLSLVTKSAH
NT seq 1665 nt   +upstreamnt  +downstreamnt
cacgacgaactgatccctttccaagacgaggggggcgaggagcaggagccgagcagcgac
agtgcctccgcgcagcgggacctggacgaggtcaagtcgtccctggtcaacgagtcggag
aaccaaagcagcagctcggactcggaggcggagaggcgcccgcagcccgcccgggacgcc
ttccagaagccgcgggactatttcaccgaagtgagaaggccccaggacggcgcgttcttt
aagggccccccgtaccctgggtacccgttcctgatgatcccggacttgagcagtccgtac
ctctccaacggacccttgtctcccggaggagcgcgcacgtacctgcagatgaaatggccc
ctcctcgatgtcccctctagcgccacagtcaaggacaccaggtcaccgtccccagcacac
ttgtctaataaagttcctgttgttcagcccccgcatcacatgcacccgttgacgcccctc
atcacctacagcaacgaccacttctcccctggctcccctcccacgcacctctccccagag
atcgatccaaagacaggaatcccccggccccctcacccatctgagctgtctccgtattac
ccactgtctcctggagctgtcggacaaatcccccatcccctcggctggctcgtcccacag
caaggacagcccatgtactccctccctcctggtggtttccggcacccctaccctgccctc
gccatgaacgcctcaatgtccagcctggtttccagtcggttctctcctcacatggtggct
ccggcccatcctggtctgcccgcctcagggattccccaccccgccattgtctcccccatc
gtcaagcaggagccagcgccccccagcctcagcccggccgtgagcgcgaaatcaccagtc
acggtgaaaaaggaggaagaaaagaaaccccacgtgaagaagcctctgaatgccttcatg
ttgtatatgaaggagatgagggccaaggtggtagccgagtgcaccctgaaggaaagcgcg
gccattaaccaaatcctggggagaaagtggcacaacctgtcccgagaagaacaggccaag
tactatgaactggcccggaaggagcggcagctgcattcccagctctacccgacctggtca
gcccgggacaactatggtaagaaaaagaagaggaagagagaaaagcagctgtcacagaca
cagtcccagcagcaagtccaagaggcagagggtgctctggcctccaaaagcaagaagcca
tgtgttcagtacctgccccctgagaagtcctgtgacagccctgcctcttcccacggcagc
atgctggactccccggccaccccctccgcagccttggcgtccccggctgcccccgcggcg
acccactcggagcaagcccagcccctctccctcaccaccaagccggagagccgggcccag
ctggctttacactcggctgccttcctgtcggccaaggcgacagccacctcctctggccag
atgggcagccagcccccgctcctctcccggccactccccctcgggtccctgcccacagct
ctgctgacttctcccccctccttcccggccgcgctccatgcccaccaggccctcccagtc
ctccaggcccagcctctttccttggtcaccaagtctgcccactga

DBGET integrated database retrieval system