KEGG   Ailuropoda melanoleuca (giant panda): 100466067
Entry
100466067         CDS       T01329                                 

Gene name
DVL3
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-3
  KO
K02353  segment polarity protein dishevelled
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04330  Notch signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100466067 (DVL3)
   04330 Notch signaling pathway
    100466067 (DVL3)
   04390 Hippo signaling pathway
    100466067 (DVL3)
   04150 mTOR signaling pathway
    100466067 (DVL3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100466067 (DVL3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100466067 (DVL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100466067 (DVL3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100466067 (DVL3)
   05226 Gastric cancer
    100466067 (DVL3)
   05217 Basal cell carcinoma
    100466067 (DVL3)
   05224 Breast cancer
    100466067 (DVL3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100466067 (DVL3)
   05022 Pathways of neurodegeneration - multiple diseases
    100466067 (DVL3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100466067 (DVL3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100466067 (DVL3)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 100466067
NCBI-ProteinID: XP_019651352
Ensembl: ENSAMEG00000017270
LinkDB
Position
1
AA seq 716 aa
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFCADNPSELPPPMERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHTTRLNGTAKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDQKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSMASSLRSHHTHPSYGPPGVPP
LYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgggcgagaccaagatcatctaccacctggacgggcaggagacgccgtacctggtgaag
ctgcccctgcccgccgagcgcgtcaccttggcggactttaagggcgttctgcagcgaccc
agctataagttcttcttcaagtctatggacgacgatttcggagtggtgaaggaggagata
tccgacgacaatgctaagctgccctgcttcaatggccgggtggtgtcttggttggtgtct
gctgagggctcacacccagagccggctcccttctgtgctgacaacccatcagaactgcca
ccgcccatggagcgcacaggaggcattggggactcccggcccccatccttccaccctcat
gctggtggaggcagccaggagaacctggacaatgacacagagacggactccttggtgtct
gcccagcgcgagcggccacgcaggagggatggcccagagcacacaacccggctaaatgga
actgcaaagggggaacggcggcgagagccagggggttatgatagctcatctacacttatg
agcagcgagttagagaccaccagcttctttgattcggatgaggatgattccaccagcagg
ttcagcagctccacagagcagagcagcgcctcacgcctgatgagaagacataagcggcgg
cggaggaagcagaaggtttctcggattgagcggtcctcgtccttcagcagtatcacggac
tccaccatgtccctcaacatcatcacagtcactctcaacatggaaaagtacaactttctg
ggcatctccattgtgggccaaagcaacgagcgtggtgacggaggcatctatatcggctct
atcatgaagggtggggctgtggctgcagatggacgcatcgagccaggagatatgctgtta
caggtaaacgagatcaactttgagaacatgagtaatgacgacgcagtccgtgtactgcgg
gagattgtgcacaaaccggggcccatcaccctgactgtagccaagtgctgggacccaagt
ccacgtggttgcttcacactgcccaggagcgagcccatccggcccattgaccctgcagcc
tgggtctcccacactgcagccatgaccggcaccttccctgcctatggcatgagcccctcc
ctgagcaccatcacctccaccagctcttccatcaccagctccatccctgacacagagcgc
ctagacgacttccacctgtccatccacagtgacatggctgccattgtaaaagccatggcc
tcccctgaatctgggctggaggtccgtgaccgcatgtggctcaagattaccatccccaac
gctttcattggctcggatgtggtggactggctatatcacaacgtggaaggcttcactgac
cggagagaggcccgcaagtatgccagcaacctgctaaaagccggcttcatccgccacact
gtcaacaagatcaccttctctgagcagtgctactacatcttcggtgacctctgtggcaac
atggccaacttgtccctccatgatcacgatggttccagtggcgcctctgaccaggacacg
ctggcccctttgccgcacccaggggccgcaccttggcccatggctttcccttaccagtac
ccaccgcccccacacccctacaacccgcacccaggcttcccagagctggggtacagctat
ggtgggggcagcgccagcagtcagcacagtgaaggcagccggagcagtggctccaaccgt
agcggcagtgaccggcggaaggagaaggaccagaaggcgggggactcgaagtccggaggc
agcggcagcgagtcggaccacacaacccgcagcagcctgagggggccacgggaaagggcg
cccagcgagcgctcgggtcctgccgccagcgagcatagccaccgcagccatcactcaatg
gccagcagcctgcgcagccaccacacgcacccgagctacggcccccctggcgtgcccccg
ctctacggtccccccatgctgatgatgcccccaccgcccgcggccatggggcccccagga
gcccctccgggccgcgacctggcctctgtgccccccgaactgacagccagcagacagtcc
ttccgcatggccatgggaaaccccagtgagttctttgtggatgtgatgtga

KEGG   Ailuropoda melanoleuca (giant panda): 100471972
Entry
100471972         CDS       T01329                                 

Gene name
DVL1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1 isoform X2
  KO
K02353  segment polarity protein dishevelled
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04330  Notch signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100471972 (DVL1)
   04330 Notch signaling pathway
    100471972 (DVL1)
   04390 Hippo signaling pathway
    100471972 (DVL1)
   04150 mTOR signaling pathway
    100471972 (DVL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100471972 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100471972 (DVL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100471972 (DVL1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100471972 (DVL1)
   05226 Gastric cancer
    100471972 (DVL1)
   05217 Basal cell carcinoma
    100471972 (DVL1)
   05224 Breast cancer
    100471972 (DVL1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100471972 (DVL1)
   05022 Pathways of neurodegeneration - multiple diseases
    100471972 (DVL1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100471972 (DVL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100471972 (DVL1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 PDZ_2 Shufflon_N
Other DBs
NCBI-GeneID: 100471972
NCBI-ProteinID: XP_002929875
Ensembl: ENSAMEG00000013804
LinkDB
Position
11
AA seq 675 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEISDDNARLPCFNGRVVSWLVLAEGAHSDVGSQSTDGHTELPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESLVSHRRERARRRNREEAARTNGHPRGDRRRDLGLPPDSAST
VLSSELESSSFIDSDEDDNTSRLSSSTEQSTSSRLIRKHKRRRRKQRMRQADRASSFSSI
TDSTMSLNIITVTLNMERHHFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDINFENMSNDDAVRVLREIVSQTGPVSLTVAKCWDPTPRSYFTVPRADPVRPIDP
AAWLSHTAALTGALPRYELEEAPLTVKSDMGAVVRVMQLPDSGLEIRDRMWLKITIANAV
IGADVVDWLYAHVEGFKERREARKYASSMLKRGFLRHTVNKITFSEQCYYVFGDLCSALA
ALNLNSGSSGASDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSA
GSQQSEGSKSSGSTRSAGGSSRRALGREKERRAAGAGGSGSESDHTAPSGVGGSGWRERP
ASQLSRGSSPHSQASAAAPGLPPLYPLTKAYSVVGGPPGGPPVRELAAVPPELTGSRQSF
QKAMGNPCEFFVDIM
NT seq 2028 nt   +upstreamnt  +downstreamnt
atggcggagaccaagatcatctatcacatggatgaagaggagacgccgtacctggtcaag
ctgcccgtggcgcccgagcgcgtcacgctggccgacttcaagaatgtgctcagcaaccgg
cccgtgcacgcttacaaattcttcttcaagtccatggaccaggacttcggggtggtgaag
gaggagatctccgatgataacgccaggctgccctgcttcaatggccgtgtggtctcctgg
ctggtcctggccgagggcgcacactcagatgtaggatctcagagcactgatggtcacaca
gagctgcctcctcctcttgagagaacgggcggcattggggactcccggcctccctctttc
caccccaatgtagccagcagccgtgacgggatggacaatgagactggcacggagtctctg
gtcagccatcggcgggagcgagcccgacgccggaaccgcgaagaggctgcccggaccaac
gggcacccaaggggggaccggcggcgagacctggggctgccccccgacagtgcctccact
gtgctgagcagcgaactagagtccagtagcttcatcgattcagatgaggatgacaacaca
agccgactgagcagctccacggagcagagcacttcctcccggctcatccgcaagcacaag
cggcggcggcggaagcagcgcatgcggcaggcggaccgtgcctcttccttcagcagcatc
acggactccaccatgtccctgaacattatcaccgtcactctcaacatggagaggcaccac
tttctgggcatcagcatcgtggggcagagcaacgagcggggggacggcggcatctacatc
ggctccatcatgaagggcggggccgtggcggccgacgggcgcatcgagccgggcgacatg
ctgctgcaggtgaatgacatcaacttcgagaacatgagcaatgatgatgccgtgcgggtg
ctgcgggagatcgtgtcccagacggggcccgtcagcctcacggtggccaaatgctgggac
ccgaccccccggagctacttcaccgtcccgagggctgacccggtgcggcccatcgacccc
gccgcctggctgtcccacacggcggcgctgaccggagccctgccccgctacgagctggag
gaggctcccctgacggtgaagagtgacatgggcgctgtggtgcgcgtcatgcagctgccg
gactcgggcctggagatccgtgaccgcatgtggctcaagatcaccatcgccaacgccgtc
atcggcgcggatgtggtggactggctgtacgcgcacgtggagggcttcaaggagaggcgt
gaggctcgcaagtacgccagcagcatgctgaaacgtggcttcctccggcacacggtcaac
aagatcaccttctcggagcagtgctactacgtctttggggacctgtgcagcgctctcgca
gccctgaacctcaacagcggctccagtggggcctcggatcaggacacactggccccactg
ccccatccggccgccccctggcccttgggtcagggctacccctaccagtacccgggcccc
ccgccctgcttcccacccgcataccaggaccctggcttcagctacggcagcggcagtgct
gggagtcagcagagtgaaggaagcaaaagcagtgggtccacccggagcgccggcgggagc
agccggcgggcactgggccgtgagaaggagcgccgggcggctggagccgggggcagtggc
agtgagtcggaccacacagcaccgagtggggttggtggcagcggctggcgggagcgccca
gctagtcagctcagccggggcagcagcccacacagccaggcctcggctgctgccccaggg
ctccccccattgtatcccttaacaaaggcatactcggtggtgggggggccgcctgggggg
ccgcccgtccgggagctggctgctgttcccccagagctgacgggaagccgccagtccttc
cagaaggccatgggaaacccctgtgaattttttgttgacatcatgtga

KEGG   Ailuropoda melanoleuca (giant panda): 100480005
Entry
100480005         CDS       T01329                                 

Gene name
DVL2
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-2 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04330  Notch signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100480005 (DVL2)
   04330 Notch signaling pathway
    100480005 (DVL2)
   04390 Hippo signaling pathway
    100480005 (DVL2)
   04150 mTOR signaling pathway
    100480005 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100480005 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100480005 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100480005 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100480005 (DVL2)
   05226 Gastric cancer
    100480005 (DVL2)
   05217 Basal cell carcinoma
    100480005 (DVL2)
   05224 Breast cancer
    100480005 (DVL2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100480005 (DVL2)
   05022 Pathways of neurodegeneration - multiple diseases
    100480005 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100480005 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100480005 (DVL2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX DEP PDZ
Other DBs
NCBI-GeneID: 100480005
NCBI-ProteinID: XP_034503071
Ensembl: ENSAMEG00000016497
LinkDB
Position
17
AA seq 735 aa
MAGSGAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMPPPAHEPRTELAPPPPPLPPL
PPERTSGIGDSRPPSFHPNVSSSRENLEPETETESVVSLRRERPRRRDSSEHGAGGHRPS
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEDDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRLERASSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTMTSGSSLPEGCEGRGLSIH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGDPGGADGGPPPSRGSSGGAPNLRAH
PGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSF
HMAMGNPSEFFVDVM
NT seq 2208 nt   +upstreamnt  +downstreamnt
atggcgggcagcggcgcggggggcggtggtgtcggggagacgaaggtgatttaccacctg
gatgaagaagagactccctacctggtgaagatccccgttcccgccgagcgcatcaccctc
ggcgatttcaagagcgtcctgcagcggcccgcgggcgctaagtactttttcaagtctatg
gatcaggatttcggggtggtgaaggaggagatttcggatgacaacgcccgccttccctgc
ttcaacggaagggtggtgtcctggctagtgtcatcagataacccccaacccgagatgcct
cccccagcccatgagcctcggacagaactggcgccaccccccccaccattaccccctttg
cccccggagaggaccagcggcattggggactccaggcctccatccttccaccctaatgtg
tccagcagccgggaaaacctggagcctgagacagaaacggagtcggttgtgtctctgcgg
cgggagcggcctcgcaggagagacagcagtgagcatggcgcggggggccacaggcccagt
ggcccctccaggctggagcgccacctggctgggtacgagagctcctccaccctcatgacc
agcgagctggagagcaccagcctgggagactcagacgaggatgacaccatgagcaggttc
agcagctccacggagcagagcagcgcctcccgcctcctcaagcgccaccggcggcggagg
aaacagcggccaccccgcctggagagggcctcgtccttcagcagcgtcaccgactccacc
atgtcgctcaacatcatcacggtcacgctgaacatggagaagtacaacttcctgggcatc
tccatcgtgggccagagcaacgagcggggcgacggcggcatctacatcggctccatcatg
aaggggggtgccgtggcggctgacgggcgcatcgagccgggcgacatgctgctgcaggtg
aatgacatgaacttcgagaacatgagcaacgacgacgcagtgcgggtgctgcgggacatc
gtgcacaagccaggccccattgtgctgacggtggctaagtgctgggatccctctcctcag
gcctatttcactcttcctcgaaatgagcccatccagcccatcgaccccgctgcctgggtg
tctcactctgctgcgctgactggcaccttcccagcctatcccggctcctcgtccatgagc
accatgacatcggggtcctctctgcctgagggctgtgagggccggggtctctccatccac
acggacatggcgtctgtgaccaaggctatggcggccccagagtccgggctggaagttcgg
gaccgcatgtggctcaagatcactatccctaatgcttttctgggctcggacgtggtggac
tggctctaccatcacgtggaaggctttcctgagcggcgggaggcccgcaagtacgccagt
gggctgctcaaggcgggtctcatccgacacaccgtgaacaagatcaccttctccgagcag
tgctattacgtcttcggggacctcagcggcggctgtgagagctaccttgtcaacttgtct
ctgaatgacaatgatggttccagcggggcgtcggaccaggacaccttggctcctctgcct
ggggcgaccccctggcccctgctgcccaccttctcataccagtacccggccccgcaccca
tacagcccccagccgccaccctaccacgagctctcgtcctacacctacgggggcggcagt
gccagcagccagcacagcgaggggagccggagcagtgggtcaacgcgcagcgatgggggg
gcagggcgtacagggaggcctgaggagcgggccccagagtccaagtccggcagtggcagt
gagtctgagccctccagccgtgggggcagcctccggcggggcggggatccaggcggggct
gatgggggccctcccccttccagaggctcgtcagggggtgctcccaatctccgagcccac
cctggcctccatccctacggaccgccccccgggatggccctcccctacaatcccatgatg
gtggtcatgatgccgccgcctccaccccctgtccctccagccgtgcagccccccggggcc
cctccagtcagagacctgggctctgtgcccccagaactgacggcgagccgccaaagcttc
cacatggccatgggcaaccccagtgagttctttgtggacgttatgtag

DBGET integrated database retrieval system