KEGG   Ailuropoda melanoleuca (giant panda): 100466242
Entry
100466242         CDS       T01329                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X2
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04020  Calcium signaling pathway
aml04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100466242 (CACNA1E)
   04020 Calcium signaling pathway
    100466242 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100466242 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aml04040]
    100466242 (CACNA1E)
Ion channels [BR:aml04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100466242 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 100466242
NCBI-ProteinID: XP_011223497
Ensembl: ENSAMEG00000007637
LinkDB
Position
8
AA seq 2457 aa
MVPEMRGLSPGRRLPEPAPCPAAGGSPEPWAAGRHRHVLALPEEEAWRPQQCSLLETDAS
DEVGMLPASPRAAAAGFDNFFPVQEGEGPGWEGGAALEAGSSPFLPVSPEVMKRRRGGLI
EQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASG
PAAAYKQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYM
ILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGVFCFEAGIKIVALGFIFHKGS
YLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSI
MKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFTNNSGILEGFDPPHPCGVQGCP
AGYECRDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPL
IIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVM
LAEENKNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSAKVDG
ASYFRHKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFL
FLGLFLLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRAL
RLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDG
TPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTL
LNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRH
HMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPL
SPLNPLNAHPSLYRRPRPIEGLGLGLEKCEEERISRGGSLKGDGGDLSSALDNQRSPLSL
GKREPPWLTRPCHGNCDPTQQEAGGGETVVTFEDRARHRQSQRRSRHRRVRTESKELSST
SRSRSASQERSLDEGVPTEGEKDREPRGSHAGKEPTIQEERGQDLRRTNSLMVPRGSGLA
GALDEANTPLVLAQPELEVGKDTALTEQEAEGSSEQALLGDVQLDMGRAISRSEPDLSCT
TANTDKATTDSTSVTVAIPDVGPLVDSTVVHISNKTDGEASPLKEAEIKEEEEEVEKKQQ
KKEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVSLRYFEMCILLVIAASSIALAAEDPV
LTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVA
FALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVY
KLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYD
NIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVN
IFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVV
SPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGFLN
YFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRIL
LWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLL
FRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLN
LFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLG
LGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQ
KETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNA
PMFQRMEPSSLPQEIIANAKALPYLQQDPVSGLSGHSGYPSMSPLSPQEIFQLACMDPAD
DGQFQEQQSLEPEVSELKSVQSSSHGIYLPSDTQEHTGSGRASSMPRLTVDPQVVTDPSS
MRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTH
RSGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERQQSRSPSEGRSQTPNRQGTG
SLSESSIPSVSDTSTPRRSRRQLPPVPPKPRPLLSYSSLLRHTGSISPPADGSEGGSPLT
SQALESTEPGLVEASSSRHVPQGQHSSPQRYISEPYLALHEDSHASDCGEEETLTFEAAM
ATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGVMCGAVSDLLSDTEEDDKC
NT seq 7374 nt   +upstreamnt  +downstreamnt
atggtgcccgagatgcgtggactgagcccaggccgcaggctgcccgagcccgccccctgc
cccgccgcaggcgggagccctgagccctgggccgcaggccgccaccgccacgtcctggcc
ctgcctgaggaggaggcatggcggccccagcagtgctccctgctcgagaccgacgcctcg
gacgaggtgggcatgctgccggcctccccgcgcgccgctgccgccggcttcgacaacttc
ttcccggtgcaggagggcgagggcccgggttgggagggcggcgcggccctggaggctggc
tccagccctttcctcccggtgagccccgaggtgatgaagcggcggcgcgggggcctcatc
gagcagagagacatcatcaaggcccacgaggcgcacaagatgcagagcaccccgcaggcc
cgacgcaaggagtgggagatggctcgcttcggggaggcggtggtcggcaggccagggtcg
ggcgatggagactcggaccagagcaggaaccggcaaggaaccccggtgccggcctcgggg
ccggcggccgcctacaagcagtcgaaagcgcagagggcgcggactatggctttgtataac
cccattcccgtccggcagaactgtttcaccgtcaacagatccctgttcatcttcggagaa
gataacattgtcaggaaatacgccaagaagctcatcgattggccgccatttgagtacatg
attttggccaccatcattgccaactgcattgtcttggccctggaacagcatcttcctgag
gatgacaagaccccgatgtcccgcagactggagaagacggaaccgtacttcattggggta
ttttgctttgaagctggtatcaaaattgtggccctggggttcatcttccataagggctcg
tacctccgcaatggctggaatgtcatggacttcatcgtagtcctcagtggcatcctggcc
acggcaggaacccacttcaacacacacgtggacctgaggaccctccgggctgtgcgcgtc
ctgaggcccctgaagctcgtgtcagggatacctagcctgcagattgtgttgaagtccatc
atgaaggccatggtgcctcttctgcaaattggccttctgctcttctttgccatcctgatg
tttgctatcattggcttggagttctacagtgggaagttgcaccgcgcgtgtttcacgaac
aattcaggtattctggaaggatttgacccccctcacccatgtggtgtgcagggctgccca
gctggttatgaatgccgggactggattggccccaatgatgggatcacccagtttgataac
atcctttttgctgtgctgaccgtcttccaatgcatcaccatggaagggtggaccaccgtg
ctgtacaataccaatgatgccttaggagccacctggaactggctgtacttcatccccctc
atcatcattggatccttctttgttctcaacctagttctgggagtgctctccggggaattt
gccaaagagagagagagagtggagaaccggagagcgttcatgaaactgcggcggcagcag
cagattgagcgcgagctgaacgggtaccgcgcctggatagacaaagcagaggaagtcatg
cttgctgaagaaaataaaaatgctgggacatcagccttagaagtgcttcgaagggcaacc
atcaaaaggagccggacggaggccatgactcgagactccagcgacgaacactgtgttgat
atctcctctgtgggcacacctctcgcccgagccagcatcaaaagtgcaaaggtggatggg
gcttcctatttccggcacaaagaaaggcttctgcgcatctcaatccgccacatggtgaaa
tcccaggtgttttattggatcgtgttgagcctcgtggctctcaacaccgcctgtgtggcc
atcgtccatcacaaccagccccagtggctcacccatctcctctactatgcagaatttctg
tttctgggactgttcctcttggagatgtccctgaagatgtatggcatggggcctcgactt
tattttcactcttcattcaactgttttgattttggggtcacagtgggcagtatctttgaa
gtggtctgggcaatcttcagacctggtacatcttttggaatcagtgtcttgagagctctc
cggcttctaagaatatttaaaataaccaagtattgggcatctctgcgaaatctggtcgtc
tctttgatgagttctatgaagtctattatcagtttgctcttcctcctcttcctcttcatc
gttgtctttgctctcctcggaatgcagctgtttggaggcaggtttaactttaatgatggg
actccttcagcaaactttgacaccttccctgcagccatcatgactgtattccagatccta
acaggggaggactggaatgaggtgatgtacaatgggatccgctcccagggtggggtgagc
tcaggcatgtggtcagctatctatttcattgtgctcaccttgtttggaaactacacactg
ctgaatgttttcttggccattgctgtggacaatctggccaatgcccaagagctgaccaag
gatgagcaagaagaagaggaggctttcaaccagaaacatgcattgcagaaggccaaggag
gtcagcccgatgtctgcgcccaacatgccttctatcgaaagagacagaaggagaagacac
cacatgtcgatgtgggagccacgcagcagccacctgagggagcggaggcgccggcaccac
atgtcggtgtgggagcagcgcaccagccagctgagaaggcacatgcagatgtccagccag
gaggccctcaataaagaggaggccccaccaatgaaccccctcaaccccctcaacccgctg
agccccctcaacccactcaatgcccaccccagcctctaccggagacccaggcccatcgag
ggcctgggcctgggcctggagaagtgtgaggaggaacgcatcagccgtggggggtccctc
aagggggatggaggggacctgtcgagtgccctagataaccagaggagccccttgtccctg
ggcaaacgggagccaccgtggctgaccaggccctgtcatggcaactgtgatccaacccag
caggaggctgggggaggggagactgtggtgaccttcgaggaccgcgccaggcacaggcag
agccagcggcgcagccggcaccgtcgtgtcaggacagaaagcaaggagctctcctccacc
tcccggagcaggtctgccagccaggagcggagtctggatgagggggtgcccaccgagggg
gaaaaggaccgcgagcccaggggcagccatgcgggcaaggagcccacaatccaggaagag
agaggccaagacttaaggaggaccaacagcctgatggtgcccagaggctccgggctggca
ggagccctagatgaggccaacacgcccctggtcctggcccagccagagctggaagtgggg
aaggacacggcactgacggagcaggaggcggagggcagcagtgagcaggccctgctgggc
gacgtgcagttggacatgggcagggccatcagccggagtgagcctgacctctcctgcacc
acggccaacacagacaaggccaccaccgacagcaccagcgtcaccgtcgccatccccgac
gtgggccccttggtggactcaactgtggttcacattagcaacaagactgatggagaagcc
agtcccttgaaggaggcagagatcaaagaggaggaggaggaagtggagaagaagcagcag
aaaaaggagaagcgtgagacgggcaaagccatggtgccccacagctccatgttcatcttc
agcaccaccaacccgatccgcagggcctgccactacatcgtgagcctgcgctactttgag
atgtgcattctcctggtgatcgcggccagcagcatcgccctggcagccgaggaccccgtc
ctgaccaactcggagcgcaacaaagtcctgaggtattttgactatgttttcactggcgtg
ttcacctttgagatggttataaagatgatagaccagggcttgatcctgcaggacgggtcc
tacttccgagacctgtggaacatcctggacttcgtggtggttgttggcgcattggtggcc
tttgctttggcgaacgctttgggaacaaacaaggggcgagacatcaagaccatcaaatct
ctgcgggtcctccgagttctgaggccactgaagaccatcaagcgcttgcctaagctcaag
gctgttttcgactgtgtggtgacctccttgaagaatgtcttcaacatcctcattgtctac
aagctcttcatgttcatctttgctgtcattgcggttcagctcttcaagggaaaattcttt
tattgcacagacagttccaaagacacagagaaggagtgcataggcaactatgtagatcat
gaaaaaaacaagatggaggtgaaaggccgggaatggaagcgccatgaattccactacgac
aacattatctgggccctgctgaccctcttcaccgtctccacaggggaaggatggcctcaa
gtgttacagcactctgtcgatgtgacagaggaagaccgaggaccaagccgcagcaaccgc
atggagatgtccatcttttacgtggtctactttgtggtcttccctttcttctttgtcaat
atctttgtggctctcatcatcatcaccttccaggagcaaggggacaagatgatggaggag
tgcagcctggagaagaatgagagagcgtgcatcgacttcgccatcagcgccaaacctctc
acccgctacatgccgcagaacaggcacacgttccagtaccgggtctggcactttgtggtg
tccccgtccttcgagtataccatcatggccatgatcgccttgaacaccgttgtgctgatg
atgaagtactattctgctccctgtacctacgaactggccctgaagtacctgaatatcgcc
ttcaccatggtgttctccctggagtgtgtcctgaagatcatcgcatttggcttcttgaac
tattttcgagacacctggaatatctttgacttcatcaccgtgattggcagtatcacagaa
atcattctgacggacagcaagctggtgaataccagtggcttcaatatgagctttctgaag
cttttccgagctgcccgcctcatcaagcttctacggcagggctacaccatccgaatttta
ctttggacctttgtgcagtcctttaaggccctcccctacgtctgccttttgattgccatg
cttttcttcatctatgccatcattgggatgcaggtatttggaaacataaaattagatgag
gagagtcacatcaaccggcacaacaacttccggagtttctttgggtccctcatgttactc
ttcaggagtgccacaggtgaggcctggcaggagataatgctgtcgtgcctcggggagaaa
ggctgcgaacccgacaccaccgcaccttcagggcagaacgagaacgagcgctgtggcaca
gacctggcctacgtttactttgtctccttcatcttcttctgctctttcttgatgctcaac
ctgtttgtggccgtcatcatggacaacttcgagtacctgactcgggactcctccatctta
gggcctcaccacttggacgagtttgtccgcgtctgggcggaatatgacagagctgcatgt
ggccgcatccattacactgagatgtatgaaatgctgactctcatgtcaccaccgctaggc
ctcggcaagagatgtccctccaaagtggcatataagaggttggtcctgatgaatatgcca
gtagccgaggacatgaccgtccacttcacctctacacttatggctctgatccggacagct
ctggacatcaaaattgccaaaggtggtgcagacaggcagcagctagactcggagctgcaa
aaggagaccctggccatttggccccacctgtcccagaagatgctagatctgcttgtgccc
atgcccaaagcctctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggac
tactataaacagagtaaggtgaagaagcagaggcagcagctggaggaacagaaaaatgca
cccatgttccagcgcatggagccctcatctctgcctcaggagatcattgctaatgccaaa
gccctgccctatctccagcaggaccctgtttcaggcctgagcggccatagtggataccct
tcgatgagtccgctctccccccaggaaatattccagttggcttgtatggacccagccgat
gatggacagttccaggaacaacagtctctggagccagaggttagtgaattaaaaagcgtg
cagtcctctagccatggcatctaccttccttcggacacccaggagcatacgggatctggg
agggcatcctctatgccacgcctgactgtggatccccaggtggtgacagatcctagctcc
atgagacgttcattttccacgattcgggataagcgttcaaattcctcatggttggaggaa
ttctccatggaaagaagcagtgaaaacacctacaagtcacgtcgccggagttaccactcc
tcgctgagactgtcagctcatcgcctgaattctgactcaggccacaagtctgacacccac
cgctcagggggcagagagcggggacggtcgaaagagcgaaagcatcttctctctcccgat
gtctcccgctgcaactcagaggagcgagggactcaggccgactgggagtccccggagcgc
cagcagtccaggtctcccagtgagggcaggtcgcagacccccaaccgacagggcacaggc
tccctgagtgaaagctccatcccctccgtctctgacaccagcaccccaagacgaagtcgc
cggcagctcccccctgttccaccaaagcctcggcccctcctttcctacagctccctgctg
cgccacaccgggagcatctctcccccggctgacggaagcgagggtggctccccgctgacc
tcccaggcgctggagagcacagagcctggcctggtggaggcttccagctcccggcatgtc
ccgcagggccagcactcctccccacagcgctacatctccgagccctacctggccctgcac
gaagactcccacgcctcagactgtggcgaggaggagacgctcaccttcgaagctgccatg
gccaccagcctgggccgctccaacaccattggctcagcgccaccgctgcggcacagctgg
cagatgcccaacgggcactatcggcggcggcggcgcgggggaccggggccaggtgtgatg
tgtggggctgtcagcgacctcctgagtgacacggaagaagacgacaagtgctag

DBGET integrated database retrieval system