KEGG   Ailuropoda melanoleuca (giant panda): 100466256
Entry
100466256         CDS       T01329                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X5
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04012  ErbB signaling pathway
aml04020  Calcium signaling pathway
aml04024  cAMP signaling pathway
aml04066  HIF-1 signaling pathway
aml04114  Oocyte meiosis
aml04217  Necroptosis
aml04261  Adrenergic signaling in cardiomyocytes
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04713  Circadian entrainment
aml04720  Long-term potentiation
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04728  Dopaminergic synapse
aml04740  Olfactory transduction
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04916  Melanogenesis
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04925  Aldosterone synthesis and secretion
aml04934  Cushing syndrome
aml04971  Gastric acid secretion
aml05012  Parkinson disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05031  Amphetamine addiction
aml05152  Tuberculosis
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05214  Glioma
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100466256 (CAMK2D)
   04310 Wnt signaling pathway
    100466256 (CAMK2D)
   04066 HIF-1 signaling pathway
    100466256 (CAMK2D)
   04020 Calcium signaling pathway
    100466256 (CAMK2D)
   04024 cAMP signaling pathway
    100466256 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100466256 (CAMK2D)
   04217 Necroptosis
    100466256 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100466256 (CAMK2D)
   04922 Glucagon signaling pathway
    100466256 (CAMK2D)
   04912 GnRH signaling pathway
    100466256 (CAMK2D)
   04921 Oxytocin signaling pathway
    100466256 (CAMK2D)
   04916 Melanogenesis
    100466256 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    100466256 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100466256 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    100466256 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    100466256 (CAMK2D)
   04728 Dopaminergic synapse
    100466256 (CAMK2D)
   04720 Long-term potentiation
    100466256 (CAMK2D)
   04722 Neurotrophin signaling pathway
    100466256 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    100466256 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    100466256 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    100466256 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100466256 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100466256 (CAMK2D)
   05205 Proteoglycans in cancer
    100466256 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    100466256 (CAMK2D)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100466256 (CAMK2D)
   05022 Pathways of neurodegeneration - multiple diseases
    100466256 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    100466256 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100466256 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100466256 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100466256 (CAMK2D)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100466256 (CAMK2D)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100466256 (CAMK2D)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 100466256
NCBI-ProteinID: XP_011227775
Ensembl: ENSAMEG00000009200
LinkDB
Position
11
AA seq 513 aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKEPQTTVIHNPDGNKESTESSNTTIEDEDVKAR
KQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKS
NKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVH
FHRSGSPTVPIKPSCIPNGKENFSGSTSLWQNI
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggcttcgaccacaacctgcaccaggttcacggacgagtatcagcttttcgaggagctc
ggaaagggggctttctcagtggtgagaagatgtatgaaaatccctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcagaaactggaaaga
gaagctagaatctgccgtcttttgaagcaccccaatattgtgcgacttcatgacagcata
tcagaagagggcttccattatttggtgtttgatttagttactggaggtgaactgtttgaa
gacatagtggcgagagagtattacagtgaagctgatgccagtcattgtatacagcagatt
ctagaaagtgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagctagcaaatccaagggagcagctgtgaaactggcagactttggctta
gccatagaagttcaaggagaccagcaggcgtggtttggttttgctggcacacctggatat
ctttctccagaagttttacgtaaagatccttatggaaagccggtggatatgtgggcatgc
ggtgtcattctctatatcctcctggtgggatatccacccttctgggatgaagatcaacac
agactctatcagcagatcaaggctggagcttatgattttccatcaccagagtgggacaca
gtgactcctgaagccaaagacctaattaataaaatgcttactatcaaccctgccaagcgt
atcacagcttcagaggcactgaaacacccatggatctgtcaacgttctactgttgcttcc
atgatgcacagacaggagactgtagactgcttgaagaaatttaatgctagaagaaaacta
aagggtgccatcttgacaactatgctggctacaaggaatttttcagcagccaagagtttg
ttgaagaaaccagatggagtaaaggagccccaaactactgtaatccacaaccctgatgga
aacaaggagtcaactgagagttcaaatacaacaattgaggatgaagatgtgaaagcacga
aagcaagaaattatcaaagtcactgaacagctgattgaagccatcaacaatggagacttt
gaagcttacacaaaaatctgtgacccaggccttactgcttttgaacctgaagctttgggt
aatttagtggaagggatggactttcaccgattctactttgaaaatgctttgtccaaaagc
aataaaccaatccacacaattatcctgaacccccatgtgcacctggtaggtgatgatgcc
gcctgcatagcgtacattaggcttacgcagtacatggatggcagcggaatgccaaagaca
atgcagtcagaagagactcgtgtgtggcatcgccgggatggaaagtggcagaacgttcat
tttcatcgctctgggtcgccaacagtacccatcaagccatcctgtattccaaatgggaaa
gaaaacttctcaggaagcacctctttgtggcaaaacatctaa

KEGG   Ailuropoda melanoleuca (giant panda): 100471632
Entry
100471632         CDS       T01329                                 

Gene name
CAMK1
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1 isoform X1
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04020  Calcium signaling pathway
aml04921  Oxytocin signaling pathway
aml04925  Aldosterone synthesis and secretion
aml05214  Glioma
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100471632 (CAMK1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100471632 (CAMK1)
   04925 Aldosterone synthesis and secretion
    100471632 (CAMK1)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    100471632 (CAMK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100471632 (CAMK1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100471632 (CAMK1)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   100471632 (CAMK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH RIO1 Tyrosinase
Other DBs
NCBI-GeneID: 100471632
NCBI-ProteinID: XP_034514621
Ensembl: ENSAMEG00000016268
LinkDB
Position
4
AA seq 370 aa
MPGAVDGPSWKQVEDIRDIYDFRDVLGTGAFSEVILAEDKRIHKLVAIKCIAKKALEGKE
GSMENEIAVLHRIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR
LIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACG
TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSP
YWDDISDSAKDFIQHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK
SKWKQAFNATAVVRHMRKLQLGTSQEGQGPTASHGELLTPAAGGPAAGCCCRDGCVEPGP
ELSPTLPPQL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgccgggggcagtggacggccccagctggaagcaggtggaggatattagggacatttac
gacttccgtgatgttctgggaacgggggccttctcagaggtaatcctggcagaagataag
agaattcacaagttggtggccatcaaatgcatcgccaagaaggctctggagggcaaggag
ggcagcatggagaatgagatcgctgtcctgcacaggatcaagcatcccaacattgtagcc
ctggatgacatctatgagagtgggggtcacctctacctcatcatgcagctggtgtctggc
ggggagctgtttgaccgcatcgtggagaaaggcttctacacggagcgggatgccagccgc
ctcatcttccaggtgctggatgccgtcaagtacctgcacgacctgggcatagtacaccga
gaccttaagccagagaatctgttgtactacagcctggatgaagactccaagatcatgatc
tctgactttggtctctccaagatggaggaccctggcagcgtgctctccacagcctgtgga
accccaggatacgtggcccctgaggtcctggcccagaagccctatagcaaggcagtggat
tgctggtccattggggtcatcgcctacattctgctctgcggttacccccccttctatgac
gagaatgatgccaaactctttgaacagattttgaaggccgagtacgagtttgactctcct
tactgggacgacatctctgactctgccaaagacttcatccagcacttgatggagaaggat
ccggaaaagaggttcacctgtgaacaggccttgcagcacccgtggattgcaggggatacg
gctctagataagaatattcaccagtcggtgagcgagcagatcaagaagaactttgccaaa
agcaagtggaagcaagctttcaatgccacggccgtggttcggcacatgaggaaactccag
ctgggcaccagccaggaggggcagggaccgacggcgagccacggggagctgctgacacca
gcagctggggggccagcggctggctgctgctgtcgagacggctgcgtggagccaggtccg
gaattgtcccctacactgcccccacagctctag

KEGG   Ailuropoda melanoleuca (giant panda): 100473015
Entry
100473015         CDS       T01329                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04020  Calcium signaling pathway
aml04024  cAMP signaling pathway
aml04211  Longevity regulating pathway
aml04371  Apelin signaling pathway
aml04380  Osteoclast differentiation
aml04720  Long-term potentiation
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04921  Oxytocin signaling pathway
aml04925  Aldosterone synthesis and secretion
aml05031  Amphetamine addiction
aml05034  Alcoholism
aml05214  Glioma
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100473015 (CAMK4)
   04020 Calcium signaling pathway
    100473015 (CAMK4)
   04024 cAMP signaling pathway
    100473015 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100473015 (CAMK4)
   04925 Aldosterone synthesis and secretion
    100473015 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    100473015 (CAMK4)
   04720 Long-term potentiation
    100473015 (CAMK4)
   04722 Neurotrophin signaling pathway
    100473015 (CAMK4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100473015 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    100473015 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    100473015 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    100473015 (CAMK4)
   05034 Alcoholism
    100473015 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100473015 (CAMK4)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100473015 (CAMK4)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   100473015 (CAMK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 Kdo Pkinase_fungal YrbL-PhoP_reg APH
Other DBs
NCBI-GeneID: 100473015
NCBI-ProteinID: XP_002919219
Ensembl: ENSAMEG00000012746
UniProt: G1M260
LinkDB
Position
3
AA seq 473 aa
MLKVTVPSCSASSCSSVTASVAPGAGSLVPDYWIEGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGVITYILLCGFEP
FYDERGDQFMFRRILNCEFYFISPWWDDVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAAKFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHSSIQDSQKASQAPS
LTQDGSEDVKSISEGEKVQGGGAQVAVEGAEAELMKVQAIGEVKDADRYATNATNMVPKA
LEDGIKVADPEIEEGLVEERLKTMEEAAAPKEGQENPALGFGAQQNDAILPEY
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcgtgctccgcctcgtcctgctcttcggtcaccgccagt
gtggccccgggggctgggagcctcgtcccggattactggatcgaaggttccaacagggat
gctttgagcgatttcttcgaggtggaatcggagctgggacggggtgctacatccattgtg
tacagatgcaaacagaaggggacgcagaagccttatgctctcaaagtgttaaagaaaaca
gtggacaaaaaaatcgtaagaactgagataggagttcttcttcgcctctcacatccaaac
atcataaaacttaaagagatatttgaaacccctacagaaatcagtctggtcctagaactg
gtcacaggaggagaactgtttgacaggattgtggagaagggatattacagtgaacgagac
gctgcagatgctgttaaacaaatcctggaggcagttgcctacctacatgaaaatgggatc
gtccatcgtgatctcaaaccagagaatcttctctatgcgactccagcccctgatgcacca
ctcaaaatcgctgactttggactctctaaaattgtggaacatcaagtactcatgaagacg
gtgtgtggaacccccgggtactgcgcacctgaaattcttagaggctgtgcctacggacct
gaggtggacatgtggtctgtaggagtaatcacctacatcttactttgtggatttgaacca
ttctacgatgaaagaggtgatcagttcatgttccggagaattctgaattgtgaattctac
tttatctccccctggtgggatgacgtatctctaaacgccaaggacctggtcagaaaacta
attgttttggatcctaagaaacggctgactaccttccaagcgcttcagcacccatgggtc
acaggtaaagcagccaagtttgtacacatggacactgctcagaagaagctccaagagttc
aatgcccggcgcaagctcaaggcagcagtgaaagctgtagtggcctcttcccggttggga
agcgccagcagcagccacagcagcatccaagacagccagaaggccagccaagcaccgtct
ctgacccaggatggcagtgaagatgttaaatctatttcagaaggagagaaagttcaagga
ggtggggcccaagtggcagttgagggggcagaggccgagctgatgaaggtacaggccata
ggggaagttaaagatgctgatagatatgctaccaacgccaccaacatggtgcccaaggca
ctagaggatggtataaaggtggctgacccggaaatagaggagggcctagtagaggagagg
ctgaagaccatggaggaagcagcagcccccaaagaagggcaagaaaacccggctctggga
tttggagctcagcagaatgatgcgatcctgccagagtattga

KEGG   Ailuropoda melanoleuca (giant panda): 100474459
Entry
100474459         CDS       T01329                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X3
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04012  ErbB signaling pathway
aml04020  Calcium signaling pathway
aml04024  cAMP signaling pathway
aml04066  HIF-1 signaling pathway
aml04114  Oocyte meiosis
aml04217  Necroptosis
aml04261  Adrenergic signaling in cardiomyocytes
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04713  Circadian entrainment
aml04720  Long-term potentiation
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04728  Dopaminergic synapse
aml04740  Olfactory transduction
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04916  Melanogenesis
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04925  Aldosterone synthesis and secretion
aml04934  Cushing syndrome
aml04971  Gastric acid secretion
aml05012  Parkinson disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05031  Amphetamine addiction
aml05152  Tuberculosis
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05214  Glioma
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100474459 (CAMK2G)
   04310 Wnt signaling pathway
    100474459 (CAMK2G)
   04066 HIF-1 signaling pathway
    100474459 (CAMK2G)
   04020 Calcium signaling pathway
    100474459 (CAMK2G)
   04024 cAMP signaling pathway
    100474459 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100474459 (CAMK2G)
   04217 Necroptosis
    100474459 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100474459 (CAMK2G)
   04922 Glucagon signaling pathway
    100474459 (CAMK2G)
   04912 GnRH signaling pathway
    100474459 (CAMK2G)
   04921 Oxytocin signaling pathway
    100474459 (CAMK2G)
   04916 Melanogenesis
    100474459 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    100474459 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100474459 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    100474459 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    100474459 (CAMK2G)
   04728 Dopaminergic synapse
    100474459 (CAMK2G)
   04720 Long-term potentiation
    100474459 (CAMK2G)
   04722 Neurotrophin signaling pathway
    100474459 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    100474459 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    100474459 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    100474459 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100474459 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100474459 (CAMK2G)
   05205 Proteoglycans in cancer
    100474459 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    100474459 (CAMK2G)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100474459 (CAMK2G)
   05022 Pathways of neurodegeneration - multiple diseases
    100474459 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    100474459 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100474459 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100474459 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100474459 (CAMK2G)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100474459 (CAMK2G)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100474459 (CAMK2G)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Pkinase_fungal SnoaL_2 Kdo RIO1
Other DBs
NCBI-GeneID: 100474459
NCBI-ProteinID: XP_011224758
Ensembl: ENSAMEG00000016709
LinkDB
Position
6
AA seq 564 aa
MGASLFSDLKRVCVTLLCSVSQFFPPSPSRGAFSVVRRCVKKTSTQEYAAKIINTKKLSA
RDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEAD
ASHCIHQILESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWF
GFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYD
FPSPEWDTVTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLR
KFNARRKLKGAILTTMLVSRNFSAAKSLLNKKSDGGVKPQSNNKNSLVSPAQEPAPLQTA
MEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSRDRTAPSAGM
QPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDF
HKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRV
WHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgggagcgtcgctgttctcagacctgaagcgtgtctgtgtcactctgctctgctccgtg
tcccagttctttcccccttctccctccaggggtgcattctctgtggtccgcaggtgtgtg
aagaaaacctccacgcaagagtatgcagcaaaaatcatcaataccaagaagttatctgcc
cgggatcaccagaagctagaacgtgaggcccggatatgccgacttttgaaacatccaaac
attgtgcgcctccatgacagtatttctgaagaagggtttcactacctcgtgtttgacctt
gttaccggcggggagctgtttgaagacatcgtggccagagagtactacagtgaagctgat
gccagccactgtatacatcagattctggagagtgttaaccacatccaccagcatgacatc
gtccaccgggacctgaagcctgagaacctgctgctagcgagtaaatgcaagggtgccgcc
gtcaagctggctgattttggcctagccatcgaagtacagggagagcagcaggcttggttt
ggttttgctggtaccccaggttacttgtcccctgaggtcttgaggaaagatccctatgga
aaacctgtggatatctgggcctgcggggtcatcctgtatatcctcctggtgggataccct
cccttctgggatgaggatcagcacaagttgtatcagcaaatcaaggctggggcctatgat
ttcccatcaccagagtgggacacggtgactcctgaagccaagaacttgatcaaccagatg
ctgaccataaaccctgcaaagcgcatcacagctgaccaggctctcaagcatccatgggtc
tgtcaacgatccacagtggcatccatgatgcatcgtcaagagactgtggagtgcttgcgc
aagttcaatgctcggagaaaactgaagggtgccatcctcacgaccatgcttgtctccaga
aacttttcagctgccaaaagcctactgaacaagaagtcggacggtggtgtcaagccacag
agcaacaacaaaaacagtctcgtaagcccagcccaagagcccgcgcccttgcagacggcc
atggagccacaaaccaccgtggtacacaacgctacagatgggatcaagggctccacagag
agctgcaacaccaccacagaagatgaagacctcaaagctgccccgctccgcactgggaat
ggcagctcggtgcctgaaggacggagctcccgggacagaacagccccctctgcaggcatg
cagccccagccttctctctgctcctcagccatgcgaaaacaggagatcattaagatcaca
gaacaactgattgaggccatcaacaatggggattttgaagcctacacgaagatttgtgat
ccaggcctcacctcctttgagcctgaggccctcggtaacctcgtggaggggatggatttc
cataagttttactttgagaatcttctgtccaagaacagcaagcccatccacaccaccatc
ctgaacccgcacgtccacgtgatcggggaggacgcagcttgcatcgcctacatccgcctc
acccagtacatcgatgggcagggtcggcctcgcaccagccagtcggaggagacccgggtc
tggcaccgccgggatggcaagtggctcaatgtccactatcactgctcaggagcccctgct
gcaccgctgcagtga

KEGG   Ailuropoda melanoleuca (giant panda): 100475467
Entry
100475467         CDS       T01329                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha isoform X2
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04012  ErbB signaling pathway
aml04020  Calcium signaling pathway
aml04024  cAMP signaling pathway
aml04066  HIF-1 signaling pathway
aml04114  Oocyte meiosis
aml04217  Necroptosis
aml04261  Adrenergic signaling in cardiomyocytes
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04713  Circadian entrainment
aml04720  Long-term potentiation
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04728  Dopaminergic synapse
aml04740  Olfactory transduction
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04916  Melanogenesis
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04925  Aldosterone synthesis and secretion
aml04934  Cushing syndrome
aml04971  Gastric acid secretion
aml05012  Parkinson disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05031  Amphetamine addiction
aml05152  Tuberculosis
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05214  Glioma
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100475467 (CAMK2A)
   04310 Wnt signaling pathway
    100475467 (CAMK2A)
   04066 HIF-1 signaling pathway
    100475467 (CAMK2A)
   04020 Calcium signaling pathway
    100475467 (CAMK2A)
   04024 cAMP signaling pathway
    100475467 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100475467 (CAMK2A)
   04217 Necroptosis
    100475467 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100475467 (CAMK2A)
   04922 Glucagon signaling pathway
    100475467 (CAMK2A)
   04912 GnRH signaling pathway
    100475467 (CAMK2A)
   04921 Oxytocin signaling pathway
    100475467 (CAMK2A)
   04916 Melanogenesis
    100475467 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    100475467 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100475467 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    100475467 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    100475467 (CAMK2A)
   04728 Dopaminergic synapse
    100475467 (CAMK2A)
   04720 Long-term potentiation
    100475467 (CAMK2A)
   04722 Neurotrophin signaling pathway
    100475467 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    100475467 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    100475467 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    100475467 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100475467 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475467 (CAMK2A)
   05205 Proteoglycans in cancer
    100475467 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    100475467 (CAMK2A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100475467 (CAMK2A)
   05022 Pathways of neurodegeneration - multiple diseases
    100475467 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    100475467 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100475467 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100475467 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100475467 (CAMK2A)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100475467 (CAMK2A)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100475467 (CAMK2A)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 100475467
NCBI-ProteinID: XP_002918206
Ensembl: ENSAMEG00000004756
LinkDB
Position
3
AA seq 489 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR
SGAPSVLPH
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgcttcacagaagagtatcagctcttcgaggaactggga
aagggagccttctcggtggtgcgccgttgcgtgaaggtgctggctggccaggagtatgct
gccaagatcatcaacacgaagaagctctcagccagagaccatcagaagctggagcgcgaa
gcccgcatctgtcgcctgctgaagcaccccaacatcgtccggctccacgacagcatctcc
gaggagggacatcattacctgatcttcgacctggttaccggtggggagctgtttgaggac
atcgtggcccgggagtattacagtgaggctgatgccagtcactgtatccagcagatcctg
gaggccgtgctgcactgtcatcagatgggcgtggtgcaccgggacctgaagccggagaat
ctgctgttggcctccaagctcaagggggccgcggtgaagctggcggactttggcttggcc
atcgaggtggagggagagcagcaggcttggttcgggttcgcaggcacgccgggatacctc
tccccagaagtgctgcggaaggacccatacgggaagcccgtggacctgtgggcctgtggc
gtcatcctctacatcctgctggttgggtaccccccattctgggacgaggaccagcaccgc
ctgtatcagcagatcaaagccggcgcctatgatttcccatcaccggaatgggacaccgtc
accccggaagccaaggacctgatcaataagatgctgaccatcaacccgtccaaacgcatc
acggccgccgaggcgctcaagcacccctggatctcgcaccggtccactgtggcctcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaatgccaggagaaaactgaag
ggagctatcctcaccacgatgctggctaccaggaacttctctggagggaagagtggagga
aacaagaagaacgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcttcagagagtaccaacaccaccatcgaggatgaagacaccaaagtgcggaaacaggag
attattaaagtgacagagcagctgattgaagccataagcaatggagattttgagtcctac
acgaagatgtgtgaccccgggatgacggccttcgaacctgaggccctggggaacctggtc
gagggcctggacttccatcgattctattttgaaaacctgtggtctcggaacagcaagccc
gtgcacaccaccatcctgaacccccatatccatctgatgggcgacgagtcggcctgcatc
gcctacatccgcatcacgcagtacctggatgcgggcggcatcccccgcacggcccagtcg
gaggagacccgcgtctggcaccgccgggatggcaaatggcagatcgtccacttccacaga
tctggggcgccctccgtcctgccccattga

KEGG   Ailuropoda melanoleuca (giant panda): 100477852
Entry
100477852         CDS       T01329                                 

Gene name
CAMK1D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1D isoform X1
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04020  Calcium signaling pathway
aml04921  Oxytocin signaling pathway
aml04925  Aldosterone synthesis and secretion
aml05214  Glioma
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100477852 (CAMK1D)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100477852 (CAMK1D)
   04925 Aldosterone synthesis and secretion
    100477852 (CAMK1D)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    100477852 (CAMK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100477852 (CAMK1D)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100477852 (CAMK1D)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   100477852 (CAMK1D)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal RIO1 APH 5_nucleotid Tyrosinase
Other DBs
NCBI-GeneID: 100477852
NCBI-ProteinID: XP_002928113
Ensembl: ENSAMEG00000017708
UniProt: G1MH77
LinkDB
Position
15
AA seq 385 aa
MARENGENSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKASGRLFAVKCIPKKALK
GKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKD
ASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMST
ACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEF
DSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN
FAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAPSTLCSLVSSS
SGVSGVGAERRPRPTTVTTVHSGSK
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggcccgggagaacggcgagaacagctcctcatggaaaaagcaagccgaagacatcaag
aaaattttcgagttcaaggagaccctcggaaccggggcgttttctgaagtggtcttagct
gaagagaaggccagtggaagactctttgcggtgaagtgcatccctaagaaggcgctgaag
ggcaaggaaagcagcatagagaacgagatagctgttctgagaaagattaagcatgaaaac
attgtcgccctggaggacatttacgaaagcccaaatcacttgtacttggtcatgcagctt
gtatccggtggagagctgtttgatcggatagtggagaaaggattttacacagaaaaagat
gccagcactctgattcgccaggtcttggatgctgtctactatctccatagaatgggcatt
gtccacagggacctcaagcctgaaaatctgttgtactacagtcaagatgaggaatccaaa
ataatgatcagtgacttcggattgtcaaagatggagggcaaaggagatgtgatgtccaca
gcctgtgggaccccaggctatgttgctcctgaggtcctggcccagaaaccgtacagcaaa
gctgttgactgctggtccattggggtgattgcctatattttgctctgcggctaccctcct
ttttatgatgaaaatgattccaagctctttgagcagatcctcaaggcagaatatgagttc
gactccccctactgggatgacatctccgactctgcaaaagacttcatccggaatctgatg
gagaaagatccaaataaaagatacacttgtgagcaagcagctcggcacccatggatcgct
ggtgacacagccctcaacaaaaacatccacgagtctgtcagtgcccagattcggaagaac
tttgcaaaaagcaaatggagacaagcatttaatgccacggccgtcgtgaggcatatgagg
aaactccatcttggcagcagcctggacagttcgaatgcaagcgtttccagcagcctcagc
ttggccagtcaaaaagattgtctggcaccctccacgctctgtagtctcgtttcttcttca
tcgggggtctctggagtgggggcggagcggagaccaaggcccaccactgtgaccacagtg
cactctggaagcaagtga

KEGG   Ailuropoda melanoleuca (giant panda): 100478243
Entry
100478243         CDS       T01329                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04012  ErbB signaling pathway
aml04020  Calcium signaling pathway
aml04024  cAMP signaling pathway
aml04066  HIF-1 signaling pathway
aml04114  Oocyte meiosis
aml04217  Necroptosis
aml04261  Adrenergic signaling in cardiomyocytes
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04713  Circadian entrainment
aml04720  Long-term potentiation
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04728  Dopaminergic synapse
aml04740  Olfactory transduction
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04916  Melanogenesis
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04925  Aldosterone synthesis and secretion
aml04934  Cushing syndrome
aml04971  Gastric acid secretion
aml05012  Parkinson disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05031  Amphetamine addiction
aml05152  Tuberculosis
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05214  Glioma
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100478243 (CAMK2B)
   04310 Wnt signaling pathway
    100478243 (CAMK2B)
   04066 HIF-1 signaling pathway
    100478243 (CAMK2B)
   04020 Calcium signaling pathway
    100478243 (CAMK2B)
   04024 cAMP signaling pathway
    100478243 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100478243 (CAMK2B)
   04217 Necroptosis
    100478243 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100478243 (CAMK2B)
   04922 Glucagon signaling pathway
    100478243 (CAMK2B)
   04912 GnRH signaling pathway
    100478243 (CAMK2B)
   04921 Oxytocin signaling pathway
    100478243 (CAMK2B)
   04916 Melanogenesis
    100478243 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    100478243 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100478243 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    100478243 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    100478243 (CAMK2B)
   04728 Dopaminergic synapse
    100478243 (CAMK2B)
   04720 Long-term potentiation
    100478243 (CAMK2B)
   04722 Neurotrophin signaling pathway
    100478243 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    100478243 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    100478243 (CAMK2B)
  09158 Development and regeneration
   04360 Axon guidance
    100478243 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100478243 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100478243 (CAMK2B)
   05205 Proteoglycans in cancer
    100478243 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    100478243 (CAMK2B)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100478243 (CAMK2B)
   05022 Pathways of neurodegeneration - multiple diseases
    100478243 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    100478243 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100478243 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100478243 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100478243 (CAMK2B)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100478243 (CAMK2B)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100478243 (CAMK2B)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 SnoaL_2 Pkinase_fungal Pex19
Other DBs
NCBI-GeneID: 100478243
NCBI-ProteinID: XP_034520833
Ensembl: ENSAMEG00000017625
LinkDB
Position
1
AA seq 463 aa
MGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKE
AYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLI
NQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTML
ATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADAVKPQTNSTKNSAAATSPK
GTLPPAALESSDSTHTTIEDEDTKAPRVPDILSSVGRGSGALEAEGPLPALSPRLSDILN
TVRRGSGAPEAQGPPPCLSPALPGPPPTLSRKQEVIKITEQLIEAVNNGDFEAYAKICDP
GLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLT
QYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPLQ
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgggggtcgtccacagggacctcaagcccgagaacctgctcttggccagcaagtgcaaa
ggggcggccgtgaagctggcggacttcggcctggccatcgaggtgcagggggaccagcag
gcatggtttgggttcgccggcacgccaggctacctgtccccggaggtcctgcgcaaggag
gcctatggcaagccagtggacatctgggcgtgcggggtgatcctgtacatcctgcttgtg
ggctacccacccttctgggacgaggaccagcacaagctgtaccagcagatcaaggcagga
gcctacgactttccatcccccgagtgggacacggtcactcctgaagccaaaaacctcatc
aaccagatgctgaccatcaaccccgccaagcgcatcacggcacacgaagcgctgaaacac
ccgtgggtctgccaacgctccaccgtggcctccatgatgcataggcaggagactgtggag
tgcttgaaaaagttcaatgcccggaggaagctcaagggcgcgatcctcaccaccatgctg
gccacgagaaatttctcagtgggcagacagaccaccgctccggccacaatgtccaccgcg
gcctccggcaccaccatggggctggtggaacaagccaagagtttactcaacaagaaggcg
gatgcggtgaagccccagacaaatagcaccaaaaacagcgccgctgccaccagcccaaag
gggacacttcctccggctgccctggagtcatcggacagcactcacaccaccatagaggat
gaggacacaaaagcccccagggtccctgacatcctgagctccgtggggaggggctcgggg
gccctggaagctgagggccccctgcccgctctgtcccccaggctctctgacatcctgaac
acggtgaggaggggctcaggggccccggaagcccagggccccccaccctgcctatctcca
gctctcccaggccccccgcccaccctgtcgcggaagcaagaggtcatcaagatcacggag
cagctcatcgaggccgtcaacaacggggacttcgaggcctatgcgaaaatctgtgaccca
ggcctgacctcgttcgagcctgaagctctgggcaatttggtcgaagggatggacttccac
agattctacttcgagaacctgctcgccaagaacagcaagcccatccacacgaccatcctg
aacccgcatgtgcacgtcatcggggaggacgccgcgtgcatcgcctacatccgcctgacg
cagtacatcgatgggcagggccggccccgcaccagccagtccgaggagacgcgcgtgtgg
caccgccgcgacggcaagtggcagaacgtgcatttccactgctcgggcgcgcccgtggcc
ccgctgcagtga

DBGET integrated database retrieval system