KEGG   Ailuropoda melanoleuca (giant panda): 100466340Help
Entry
100466340         CDS       T01329                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00052  Galactose metabolism
aml00500  Starch and sucrose metabolism
aml01100  Metabolic pathways
aml04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100466340 (MGAM2)
   00500 Starch and sucrose metabolism
    100466340 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100466340 (MGAM2)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100466340 (MGAM2)
    3.2.1.20  alpha-glucosidase
     100466340 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100466340
NCBI-ProteinID: XP_011226335
LinkDB All DBs
Position
Un
AA seq 2372 aa AA seqDB search
MARKLSILEVLLIIFFLTVLALDIFLMFFVFQKDEEAEFVPECPEIPESDRIDCAPGQVV
TEDVCRQQHKCCWKPVPDTNVPRCFFPRNWGYEANSIQNDTSTGFTAQLRKLPFPSLFGY
DVRDATFTAEYQTSNRFHFKISDTDNKRYEVPPEIINLSERTTNTSNLNYYIEVIDKPFS
IKIMRTSNRRVLLDTSIGPLQFAQQYLQLSFRLPSTAVYGLGEHVHQQYRHNMTWKTWPI
FTRDAAPTEGMINLYGAHTFFLCLEDTSGSSFGVFLLNSNAMEVTLQPAPAITYRTIGGI
LDFYVFLGNTPEQVVQEYLELIGRPFLPPYWSLGFQLSRRNYSGISGLKKVVDRNRVAGI
PYDVQYSDIDYMDGNKDFTVDKQAFPNLSDFTSDLHKQGLKYVIVMNPGILNNSDYPPYM
NGRTKRVWILGDNGFVVGQGYPGWTVFPDYSNPICTQWWKEQLSEFHQSLEFDGVWIEMD
EVSSFLQGSDRGCEWNTFNFPPFTPRILDRLLFARTLCMDAEFQWGLHYDVHSLYGYSMA
KATHSAMENIFPNKSSFILSRSTFAGSGKYAAHWLGDNAATWNDLRWSIPSILEFNLFGI
PMVGANICGYTKNVTEELCTRWMQLGAFYPLSRNHNGPGFRDQDPAAFGEHSLLVHSSRY
YLNIRYALLPYLYTLFYRAHARGDTVARPLVHEFYQDPATWDVHEQFLWGPGLLITPVLY
EGMDRVKAYIPDAIWYDYETGVAVQWRKQWVEMLLPLDKIGLHLRGGFIFPTQQPNTTTE
ASRKNSLGLIVALDYKREAWGELYWDDGVSKDGEKQYILYDFSVSSNRLQANIINNSYMD
PNNLMFTDIIILGMDKQPTDFTVLLSNSATSISNVAYNVSSKVVEISDLKGLILGQGFSI
EWKLPVSDLEKFNCYPEDAAVSEESCKQRGCLWESTAVPDVPTCYYDTIPSYAASNIQYL
PTGITTDLAHLGAPESARAASRSLSAAVSFLRLSVVYHTENMLQFKIFDSMNKRYEVPVP
LNTPPSPVGSPEDRLYDVRIQNNPFGIQIRRKSSSTVIWDSQLPGFTFNDMFLSISTRLP
SQYIYGFGETEHTAFRRNMNWTMWGMFARDEPPAYKKNSYGVHPYYMALEEDGSAHGVFL
LNSNAMDVSFQPTPALTYRTTGGILNFYMVLGPTPELVTQQYTELIGRPAMTPYWALGFQ
LSRYGYQNDTEISHLYEAMMAAQIPYDVQHVDIDYMDRKLDFTLSPSFQNLSVLIEQMKN
NGMRFILILDPAISGNETQYRPFTRGQDNNVFIKWPNSNDIVWGKVWPELPNVNVNTSLD
HETQVKLYRANVAFPDFFRNSTAAWWKLEIKELYANSQESGKSLKFDGLWIDMNEPSNFV
DGSVRNCSDDILNNPPYVPYLESRDKGLSSKTLCMESEQVLPDGSQVRHYDVHSLYGWAQ
TRPTYEAVQEVTGQRGVVITRSTFPSSGRWGGHWLGDNTASWDQLRKSIIGMMEFSLFGI
SYTGADICGFFGNAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVAWNSTFEVFSRKVL
QTRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTNDNKTWDIDRQFMLGPALLISPVLESN
TSEISAYFPRARWYDYSTESGSVSTGEWKALGAPLDHINLHIRGGCILPWQEPAMNTHSS
RQKFMGLTVALDDNGKAEGQIFWDDGESIDTYENGNYFLAKFTAAQNLLKIQTIHNKYLS
DSNPLKVGYIKIWGTNSTSVTQVTFTYDNQQFTEMNFKSDPYNQTLTIQLTDKIISLEKL
TEVTWIYGGPIVSTTPMTNTFTTGSLYPSTVTTKATTFETILTSFATTSTTLSISTTAFP
TSTTEVTASTTGPSTTTPFLTSTIEVITSSNVPNTTTPSPPNTTATTTDFTAVPNTTTPS
PPNTTASSTTLPITGTPFPTGTTGFTASTPVPNTTTPSPPNTTASSSTLPITGTPFPTGT
TGFTASTPVPNTTMPSPPNITTSSSTLPITGTPFPTGTTGFTASTPVPNTTMPSPPNTTA
SSSTLPITGTPFPTGTTDFTAYTPVPNTTMPSPTSTTTASTSTTLPITSSPVPESTIDVT
TSTAVTNTTLPSPISTTASISTTLPIITTAFPTSNTEAITNTTVLITTTLSPTSTDTTST
NNTVPITTTPSTNGSANSTINGFPIMTTFSVTTHAMNTTVAMVTTSPISTDVARTGNHTP
ITSSPSPTISGGNSTSYTIPTMSTLSTDIYTTSTNTIATPTTKTIHSTGHEVNITDTDNS
SSVPDNTTRVSIPNTTIALDTLMTALLDTEAHHQVTTNSTVSYLPIIVTNATTSIINTTA
YALNTTILDRPMNASATIPTYIANAVNATLVP
NT seq 7119 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaaactcagtatattggaagtccttctgatcatcttcttcctaactgtactg
gccttagatatcttcttgatgttttttgtgtttcagaaagatgaagaggctgaatttgtt
ccagagtgtccagagatccctgaatcagacaggatagactgtgctccaggccaggtggtg
acagaggatgtctgcaggcagcaacataagtgctgctggaaacctgtgccagacactaat
gtccctaggtgcttcttccccaggaactggggctacgaagccaacagtatccagaatgac
acaagtacagggtttacagcccagttgagaaagttgccattcccatctctgtttggatat
gatgtgagggatgccaccttcacagctgaatatcagacatccaatcgttttcattttaag
attagtgatactgacaacaaacgctatgaagtcccccctgaaattattaacctgtctgag
aggactactaatacttccaatttgaactattacatagaggtcattgataagcccttcagc
atcaaaataatgaggacgagcaacagaagagtcctattggacacgagcatcgggcccctg
cagttcgcccagcagtacctgcagctgtccttccgtctgcccagcaccgccgtgtacggg
ctgggggagcacgtgcaccaacagtaccgccacaacatgacctggaagacctggcccatc
ttcacccgcgatgccgcccccaccgagggcatgattaatctgtatggagctcatacattc
ttcctgtgccttgaagacaccagcggctcctcttttggggtttttctattgaacagtaat
gccatggaggtcaccctgcagcctgctcctgcgatcacttaccgcacgattgggggcatc
cttgacttctatgtattcctgggaaatactccggaacaagtggttcaggaatacctggag
ctcattggacgaccattcctgcctccctactggagtcttgggttccagcttagtcgcagg
aactatagtggcatcagtggattgaagaaggttgtggatcgaaatcgtgtagctgggatc
ccttatgatgtccagtactctgacatagactacatggatggaaataaggatttcactgtc
gataaacaggctttccctaatctctcagattttaccagcgacttacataagcaaggactg
aaatatgtaatcgttatgaatcctggcatcttaaataactctgactaccccccatatatg
aatggaaggacaaagagagtatggatcttgggggacaatggctttgtcgttgggcaggga
taccccggatggaccgtctttccggattacagtaatccgatttgcactcagtggtggaag
gagcagctcagtgaatttcatcaaagtcttgagtttgatggagtgtggattgaaatggat
gaagtatccagctttctccaaggttccgatcgcgggtgtgaatggaacaccttcaacttt
cctcctttcactccccgaattctggaccgcttgctttttgcaagaaccctctgcatggat
gcagaatttcagtggggccttcactatgatgtccacagcttgtatggctactctatggca
aaagcgacacactcggccatggagaatatcttccccaacaaaagtagcttcatcttatcc
cgctctacttttgctggatctggcaaatatgctgcacactggttgggggacaatgcagcc
acatggaatgatctccgatggtccatccctagtatccttgagttcaacctatttggtatc
cccatggtaggtgccaacatctgtggttacacaaaaaatgtcacagaggagctctgcaca
agatggatgcagcttggagcattttatccactatcgaggaatcacaatgggcctgggttc
agggaccaggatccggctgcctttggcgaacactctctgctggtgcattcctccagatat
tatctgaacatccgctacgccctgctgccctacctctacaccctcttctaccgagctcac
gcccggggggacaccgtagccaggcccctggtccatgagttctaccaggacccagctact
tgggatgtgcacgagcagttcttatgggggcctggactcctcatcacacctgttttatat
gagggtatggaccgagtgaaagcatacataccagacgccatctggtacgactatgagaca
ggagtagccgtccagtggaggaaacaatgggtggagatgctgctgccactcgacaagata
ggacttcatctccgagggggcttcatatttcccacccagcagcccaacacaaccacagag
gccagtcggaagaattccctgggactcattgttgccttggactacaagagagaggcatgg
ggcgagctgtactgggatgatggtgtgtctaaagatggtgaaaagcagtatattctatat
gacttttctgtcagctctaaccgtcttcaggcaaatattataaataatagctatatggac
cctaacaacctcatgtttacagatatcataatcttgggaatggacaagcaacctactgat
tttaccgtcttacttagtaattctgccacctccatttcaaatgttgcctacaatgtttca
tcaaaggtggtggagatcagtgatctcaagggactgatacttggtcaaggattctccatt
gaatggaaacttccagtcagtgacctggagaaattcaactgctaccctgaggatgctgcc
gtctctgaagagagttgcaagcagcgggggtgcctttgggagtccacagctgttcctgat
gtgcccacctgttactacgacaccatccctagttatgccgccagtaacattcagtacctg
cctacgggcatcaccacagaccttgcccacctcggggcccctgaatcagcccgtgctgcc
tctcgctcgctctctgcggcagtcagcttcctccggctgagcgtggtctaccacacagaa
aacatgctgcagttcaagatctttgattccatgaacaaaaggtatgaggtcccagtgcct
ctaaacacccctccctctccagttggctcccctgaagaccgtctgtatgacgtcaggatt
cagaacaatccttttgggatccagattcgacgaaaaagctccagcactgtgatttgggat
tctcagctgcctggcttcacgttcaacgacatgttcctctccatttctactcgcctcccc
tctcagtacatctatggctttggggagacggagcacacagctttcagaagaaatatgaac
tggaccatgtggggaatgtttgctcgtgatgagcccccagcgtacaagaagaattcctat
ggcgtccacccctactacatggcactagaggaagatggcagtgcccatggggtgttcctg
ctaaacagcaatgccatggatgtgtcattccagcccactcctgccctgacataccgcacc
acaggagggattttgaacttttatatggttttggggccaacccctgagcttgtaactcaa
caatacactgagctgattggtcggccggcaatgactccatattgggccttgggattccag
ctaagtcgctatggataccagaatgatactgagatctcccacttgtatgaggcaatgatg
gcagcccagattccctatgatgtccagcatgtagacatcgattacatggacaggaagctg
gacttcactctcagccccagcttccaaaacctcagcgtcctgattgagcaaatgaagaat
aatggcatgagattcattctcattctggacccagccatttctggcaacgagacccagtat
cgcccattcaccagagggcaggataacaatgtattcatcaaatggcccaacagcaatgac
attgtctggggaaaggtttggccagaactgcccaacgtgaatgtgaatacctcccttgac
catgaaactcaggttaagctgtacagagccaacgttgcttttcccgacttctttcgtaat
agcacagctgcatggtggaagctggaaataaaagagctctatgcaaattctcaagagtca
gggaagagcttgaagtttgacggattgtggattgatatgaatgagccatcaaactttgtg
gatggatctgtcaggaactgcagtgatgacattcttaataacccaccctacgtgccatat
ttggagtccagggacaagggcctgagcagcaagaccctgtgcatggagagtgagcaggtc
ctgccagacggctcgcaggtgcggcactacgacgttcacagcctgtacggatgggcccag
accagacccacctacgaagctgtgcaggaggtgacgggacagcgaggggtcgtcatcacc
cgctccacattcccctcttctggccgctggggaggccactggctgggtgacaacacagcc
tcgtgggaccagctgaggaaatcgatcattggcatgatggagttcagtctcttcggaata
tcgtatacaggagcagatatttgtggcttctttggaaatgctgagtatgagatgtgtgtt
cgctggatgcaactgggggccttttatcccttttccagaaaccacaacaccatcgggaca
aggagacaagatcctgtggcctggaattcaaccttcgaggtgttctccagaaaagtcctt
cagaccagatacaccctgttgccctacctctacactttgatgcataaagctcacgttgag
ggcagcactgtcgtccgaccccttctccatgagtttacgaatgacaacaaaacatgggat
atagaccgtcagttcatgttgggtcctgctctcttaatcagccccgtgctggaaagtaac
acttctgagatctctgcttactttcccagagcccgttggtatgactacagcacggaatct
ggcagtgtgtcaacaggtgagtggaaagcactgggtgctccccttgaccacatcaacctt
catatcagagggggctgcatcctgccttggcaagagcctgcgatgaacactcactccagt
cgacaaaaatttatgggattgactgttgcattggacgacaatgggaaggctgaaggccag
atattctgggatgatggagaaagcattgatacctatgaaaatggaaactatttcttggca
aaatttacagcagctcagaatctattgaaaatccagaccatacacaataagtatttgagt
gactcgaatccactgaaagttggatatattaaaatctgggggacaaactctacttctgtg
acacaagtcactttcacctatgacaaccagcaattcacagagatgaatttcaagagtgac
ccttacaatcagactctgactattcaactgactgacaagattatcagcctagaaaaacta
actgaggttacttggatatacggtggccctatagtttctactacacctatgacaaatacc
ttcacaacaggttctctatatccttctacagttactactaaggctaccacttttgagact
attctcactagttttgctactactagtactactcttagtatctcaaccactgctttccca
acaagtactactgaagttacagctagtactactggccctagtaccactacacctttccta
acaagtactattgaagttataactagttctaatgttcctaataccactacgccttccccc
ccaaatactaccgctactactactgactttacagctgttcctaataccactacgccttcc
cccccaaatactaccgctagcagtactactcttcctatcacaggcactcctttcccgaca
ggcactactggctttacagctagtactccggttcctaataccactacgccttccccccca
aatactaccgctagcagtagtactcttcctatcacaggcactcctttcccgacaggcact
actggctttacagctagtactcctgttcctaataccactatgccttcccccccaaatatt
accactagcagtagtactcttcctatcacaggcactcctttcccgacaggcactactggc
tttacagctagtactcctgttcctaataccactatgccttcccccccaaatactaccgct
agcagcagtacccttccaatcaccggcactcctttcccaacaggtactactgactttaca
gcttatactcctgttcctaataccactatgccttccccaacaagtaccactactgctagc
actagtactacccttcctatcacaagctctcctgtcccagaaagcactattgatgttaca
actagtactgctgttactaataccactctgccttcccctataagtaccactgctagcatt
agtactactcttcctatcataaccactgctttcccaacgagtaatactgaagctatcacc
aataccactgttctaattaccactactctttctccaacaagtactgatactactagcacc
aataatactgttccaattacaactactccttctacgaatggtagtgctaatagtactatc
aatggttttcctattatgactactttttctgtaactactcatgctatgaacactactgtt
gctatggtaaccacttctcctataagtactgatgttgctcgcactggcaaccatactccc
attaccagttctccttcccctacaatatctggtggtaatagtactagttatactattcct
acaatgtctactctttctacagatatttacactactagcactaataccatagctacccct
accaccaaaactatacatagtacagggcatgaagtaaatattactgacacagataactct
agcagtgttccagataacactacacgtgtttctattccaaataccacaatagccttagac
acattaatgactgctcttctagacacagaagctcaccatcaggtaacaacaaactctaca
gtcagttatttacctattattgtaactaatgctaccaccagtattataaatactaccgca
tatgctctaaatactaccattcttgatagaccaatgaatgcttctgctaccataccaact
tatattgcaaatgccgtaaatgctactctagttccatga

DBGET integrated database retrieval system