KEGG   Ailuropoda melanoleuca (giant panda): 100466406
Entry
100466406         CDS       T01329                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor-associated factor 3 isoform X1
  KO
K03174  TNF receptor-associated factor 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04064  NF-kappa B signaling pathway
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04668  TNF signaling pathway
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100466406 (TRAF3)
   04668 TNF signaling pathway
    100466406 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100466406 (TRAF3)
   04621 NOD-like receptor signaling pathway
    100466406 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    100466406 (TRAF3)
   04657 IL-17 signaling pathway
    100466406 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100466406 (TRAF3)
   05203 Viral carcinogenesis
    100466406 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100466406 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100466406 (TRAF3)
   05160 Hepatitis C
    100466406 (TRAF3)
   05171 Coronavirus disease - COVID-19
    100466406 (TRAF3)
   05164 Influenza A
    100466406 (TRAF3)
   05162 Measles
    100466406 (TRAF3)
   05168 Herpes simplex virus 1 infection
    100466406 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100466406 (TRAF3)
   05169 Epstein-Barr virus infection
    100466406 (TRAF3)
   05165 Human papillomavirus infection
    100466406 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 zf-C3HC4_2 Crescentin MPS2 Spc7 Spc29 Cast Tropomyosin_1 KxDL T3SSipB zf-RING_6 FliJ BLOC1_2 DUF1664 Fib_alpha Exonuc_VII_L GAS DUF3450 SPATA24
Other DBs
NCBI-GeneID: 100466406
NCBI-ProteinID: XP_019654836
Ensembl: ENSAMEG00000018207
UniProt: D2HAH0
LinkDB
Position
14
AA seq 568 aa
MEPSKKMDPPGTLQTNPPLKLHPDRGAGTSVFVPEQGGYKERFVKTVEDKYKCEKCRLVL
CNPKQTECGHRFCETCMAALLSSSSPKCTACQEGIIKDKVFKDNCCKREILALQIYCRNE
GGGCTEQLTLGHLLVHLKNDCQFEELSCVRADCKEKVLRRDLRDHVEKACKYREATCSHC
KSQVPMITLQKHEDTECPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggagccaagtaaaaagatggacccccctggcaccctgcagacaaacccaccgctaaag
ctgcaccctgaccggggtgccgggacgtccgtcttcgtccccgaacaaggaggttacaaa
gaaaggtttgtgaagaccgtggaagacaagtacaagtgtgagaagtgccgcctggtgctg
tgtaacccgaagcagacagagtgcggacaccggttctgcgagacctgcatggctgccttg
ctgagctcctcaagcccaaaatgtactgcgtgtcaagaaggcatcattaaagataaggtg
tttaaggataattgctgcaagagagagatccttgctcttcagatctactgcagaaatgaa
ggtgggggctgcacagagcagttgacactggggcacctgctggtgcatttaaagaacgat
tgccagtttgaagagctttcatgcgtccgcgctgactgcaaagaaaaagtgttgcgaaga
gacctgcgtgaccacgtggaaaaggcctgcaagtaccgggaggccacgtgcagccactgc
aaaagtcaggtcccgatgatcacgctgcagaaacatgaagacactgagtgtccctgtgtg
gtggtgtcctgcccccataagtgcagtgtccagacccttttgaggagtgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtt
tttcaggggacaaaccagcagattaaggcccatgaggccagctccgcggtgcagcatgtc
aacttactgaaagagtggagtaactctctagagaaaaaggtttccctgctacagaatgaa
agtgtagagaaaaacaagagtatacaaagcttgcacaatcagatatgtagctttgaaatt
gaaattgagagacaaaaggaaatgctccgaaataatgaatccaaaatacttcatttacag
cgagtgatagacagtcaggcggaaaaactgaaagagctggacaaagagatccgccccttc
cggcagaactgggaagaagcagacagcatgaagagcagcgtggaatccctccagaaccga
gtgacggagctggagagtgtggacaaaagtgcaggacaggcggctcggaacacaggcttg
ctggagtcccagctgagccggcatgaccagatgctgagcgtccacgacatccgcctggcc
gacatggacctgcgcttccaggtcctggagactgccagctacaatggcgtgctgatttgg
aagatccgagattataagcggcggaagcaggaagccgtcatggggaagacactgtctctt
tacagccagcctttctacacaggctattttggctataagatgtgtgccagggtctacctg
aacggggatggcatggggaaggggacgcatttgtcgctgttctttgtcattatgcgcgga
gagtatgacgccctgcttccttggccgttcaagcagaaagtgacgctcatgctgatggat
caggggtcctctcggcgccacctgggagatgcgttcaagccggaccccaacagcagcagc
ttcaagaagcccaccggggagatgaatattgcctctggctgcccagtgtttgtggcccaa
actgtgctagaaaacgggacatatattaaagatgataccatttttattaaagtcatagtg
gatacttcggatctgcccgacccctga

DBGET integrated database retrieval system