KEGG   Ailuropoda melanoleuca (giant panda): 100466442
Entry
100466442         CDS       T01329                                 

Gene name
MAP3K1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04120  Ubiquitin mediated proteolysis
aml04530  Tight junction
aml04622  RIG-I-like receptor signaling pathway
aml04722  Neurotrophin signaling pathway
aml04912  GnRH signaling pathway
aml04935  Growth hormone synthesis, secretion and action
aml05161  Hepatitis B
aml05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100466442 (MAP3K1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100466442 (MAP3K1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100466442 (MAP3K1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100466442 (MAP3K1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100466442 (MAP3K1)
   04935 Growth hormone synthesis, secretion and action
    100466442 (MAP3K1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100466442 (MAP3K1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100466442 (MAP3K1)
   05161 Hepatitis B
    100466442 (MAP3K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100466442 (MAP3K1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aml04121]
    100466442 (MAP3K1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100466442 (MAP3K1)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: STE group
  STE11 family
   100466442 (MAP3K1)
Ubiquitin system [BR:aml04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100466442 (MAP3K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal zf-RING_2 PHD APH Phostensin_N FANCL_C zf-ANAPC11
Other DBs
NCBI-GeneID: 100466442
NCBI-ProteinID: XP_034511522
Ensembl: ENSAMEG00000003644
LinkDB
Position
3
AA seq 1500 aa
MTNLLKFIRKFIAAMLPDKPSTWPGAEGTEATTLGATCASRAEWGRRVGPRPGSPTPTAK
GSENDRPQTLSPASPSTHYTPKFERQPSLGDLPTSRAEIAAERKRRTAAAEAPPLAGAAR
DYLAAQRPSPAGAEPGEKRTPAAEPPPAAAPAGREMENKETLKGLHKMDDRPEERMIREK
LKATCMPAWKHEWLERRNRRGPVVVKPIPIKGDGSEIHNLSTESQGEGQASTTSPAPKGR
RSPSPSSSPSGRTVKSESPGVRRKRVSPVPFQSGRITPPRRAPSPDGFSPYSPEETNRRV
NKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCGRGTFCIHLLFVMLRVFQL
EPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNSHTLSSSSTST
SSSENSIKDEEEQMCPICLLGMLDEESLTVCEEGCRNKLHHHCMSIWAEECRRNREPLIC
PLCRSKWRSHDFYSHELSSPVDSPSSLRAAQQQTIQQQPLAGSQRRSQESSFNLTHYGAQ
QIPPAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLANGESTGNSG
SNGRSSPSAGASSGSSQTSISGDVVEACCNVLSMVCGDPVYKVYVAALKTLRAMLVYTPC
HSLAERIKLQRLLRPVVDTILVKCADANSRTSQLSISTLLELCKGQAGELAVGREILKAG
SIGIGGVDYVLSCILGNQTESNNWQELLGRLCLIDRLLLEFPAEFYPHIVSTDVSQAEPV
EVRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTAVPHVFSKLLEMLNVSSST
HFTRMRRRLMAIADEVEIAEAIQLGVGDTLDGRHDSFLQASVSTSYPETTENSSLERTDH
LEKTGKGLCATKLSANLEDITDRLGSISVGLPSSTTIEQPKPMVQTKGRPHSQCLNTSPL
SHHSPLMFPPLSTPSSSAPSAPTGTGTDVSKHRPQGFIPCKIPSPSPQTQRKFSLQFQRN
CSENRDSDKLSPIFTQSRPLPSSNIHRPKPSRPTPGNTSQQGDASKNSLTLDLNCTAQCD
DSFGRSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSE
VAVLSPEKDENDDTYKDDVNHNQKCKEKMEAEEEAALAIAMAMSASQDALPIVPQLQVEN
GEDIIIIQQDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVK
QVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVA
HLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAA
ARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAE
KHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW
NT seq 4503 nt   +upstreamnt  +downstreamnt
atgacgaatttgctgaaattcatcagaaaattcatcgcagctatgttaccagacaagcca
tccacatggccaggggcagaagggacagaggcgacaaccctgggcgccacctgcgcgtcc
cgcgcggagtgggggaggagggttggtcctcgcccgggctccccgacgcccactgcaaag
ggcagtgagaatgacagaccgcaaaccctctcgcctgcgtccccttcaacgcactacaca
cctaagttcgaacggcaaccctcgctaggcgacctcccgaccagccgggccgagattgcg
gcggagaggaagcggcgcactgccgccgccgaagctcctcctctcgccggtgcagcccgg
gactacctggcggcccagcgaccgagccccgcgggggccgagcctggggagaagcggacg
cccgccgccgagccgcctcctgcagcggcccccgccggtcgtgagatggagaacaaagaa
actctcaaggggttgcacaagatggacgatcgcccagaagaacgaatgatcagggagaaa
ctgaaggcaacctgtatgccagcctggaagcatgagtggctggaaaggagaaataggaga
ggccctgtggtggtaaaaccaatccctattaaaggagatggttctgaaattcacaacttg
tcaactgagtctcaaggagagggccaggcgagcaccacgtcacccgctcccaaaggccga
cgcagtccttctcctagcagctccccatcaggtcgcacagtgaagtcggaatctccagga
gttcggagaaaaagagtttccccagtgccttttcagagtgggcgaatcacaccacctcga
agagccccttcaccggatggcttctcaccatacagccctgaggagacaaaccgccgtgta
aacaaagttatgcgggccaggctgtacttactgcaacaaataggacccaactctttcctg
attggaggagatagcccagataataaataccgggtgtttattgggcctcagaactgcagc
tgtgggcgtggaacattctgtattcatctgttgtttgttatgctccgggtgtttcaacta
gaaccttcagacccaatgttatggagaaaaactttaaagaattttgaggttgaaagtttg
ttccagaaatatcacagtaggcgtagctcaaggatcaaagctccatctcgtaacaccatc
cagaagtttgtttcacgcatgtcaaattctcatacattgtcatcatctagtacttctaca
tctagttcagaaaacagtataaaagatgaggaggaacagatgtgtcctatttgcttgctg
ggcatgcttgatgaagagagtctcaccgtgtgcgaagaaggctgcaggaacaagctgcat
caccactgcatgtcaatctgggcagaagaatgtagaagaaatagagaacctttaatatgt
cccctttgtaggtctaagtggagatctcatgatttctacagccatgagttgtcaagccct
gtggattccccttcttccctgagagctgcacagcaacaaaccatacagcagcagcctttg
gctggatcacaacggaggagtcaggagagcagttttaaccttactcattatggagctcag
cagattcctcctgcttacaaagatttagctgagccatggattcaggtatttggaatggaa
ctcgtcggctgcttattttctagaaactggaatgtaagagagatggctctcaggcgtctt
tcccacgatgttagtggggctctgctattggcaaatggggagagcactggaaattctggg
agcaacggtagaagcagcccgagtgctggagccagcagtgggtcttcccagaccagtatc
tcaggagacgtggtagaggcatgctgcaacgttttatcaatggtctgtggtgaccctgtc
tacaaagtgtacgttgctgctttaaaaacgttgagagccatgctagtatatactccttgc
catagtttggcagaaagaatcaaactgcagagacttctccggcctgttgtagacaccatc
ttagtgaagtgtgcagatgccaatagtcgtacaagtcagctgtctatatcaacactgttg
gaattatgcaaaggccaagcaggagagttggcagttggcagagaaatacttaaagctgga
tccattggtattggtggtgttgattatgtcttaagttgtattcttggaaaccaaactgaa
tcaaacaactggcaagaacttctgggtcgcctttgtcttatagacagactgctgttggaa
tttcctgctgaattttaccctcatattgtcagtactgatgtttcacaagctgagcctgtt
gaagtcaggtataaaaagctgctgtccctcttaacctttgctttgcagtccattgataat
tcccactcaatggttggtaaactctcccggaggatatatttgagttctgcaagaatggtt
actgcagtaccccacgtattttcaaaactattagaaatgctaaatgtttccagttccact
cattttaccaggatgcgtcgtcgtctgatggctattgcagatgaggtggaaattgctgag
gccatccagctgggcgtaggagacactttggatggtcgacatgacagctttttgcaggca
tctgtctctaccagctatccagaaaccacagagaacagctcccttgagcgcacagaccat
ttagagaaaactggaaaaggactgtgtgctacaaaactgagtgccaacttggaggacatt
actgacagactgggcagcatttcagtaggacttcctagttcaacaacaatagagcaacca
aagccaatggttcaaacaaaaggcagaccccacagtcagtgtttgaacacctctccttta
tctcatcattccccattaatgtttccacccttgtcaactccttcttcatctgctccctct
gcaccaactggcactggaacagatgtctctaagcatagacctcagggattcattccctgc
aaaataccttcgccatctcctcaaacacagcgcaagttttctctacagttccagagaaac
tgttctgaaaacagagactcagataaactttcccccatctttactcagtcaagacccctg
ccctctagtaatatacataggccaaagccatctcgacctaccccaggtaatacaagtcaa
cagggagatgcctcaaagaatagcttgacacttgatctgaactgtactgcccaatgtgat
gacagctttggcagaagcagcaacagcagtaatgctgtcatacccagtgatgagacagtg
ttcaccccagtagaagagaaatgcagattagatgtcaatacagagctcaactccagtatt
gaggaccttcttgaagcatctatgccttcaagtgacacaacagtaacttttaagtcagaa
gttgctgtactctctcctgaaaaggatgaaaatgatgatacctacaaagatgatgtgaat
cataatcagaaatgcaaagaaaagatggaagctgaagaagaagcagctttagcaattgcc
atggcaatgtcagcgtctcaggatgcccttcccatagttcctcaactacaagttgaaaat
ggagaagatatcatcatcattcaacaggatacaccagaaactctaccaggacataccaaa
gcaaaacaaccttacagagaagacactgaatggctgaaaggtcagcagataggccttgga
gcattttcttcctgttaccaggctcaagatgtgggaactggaactttaatggctgttaaa
caggtgacatatgtcagaaatacatcttctgagcaagaagaagtagtggaagcattaaga
gaagagatcagaatgatgagccatttgaatcatcccaacatcattaggatgttgggagcc
acatgtgagaagagcaattataatctcttcatcgaatggatggcagggggatctgtggct
catttgctcagtaaatatggagccttcaaggaatcagtagttattaactatactgaacaa
ttacttcgtggcctttcgtatctccatgaaaaccagatcattcatagagatgtcaaaggt
gccaatttgctaattgacagcacaggtcagagactgagaattgcagattttggagctgca
gcgaggttggcatcaaaaggaactggtgctggagagtttcagggacagttactggggaca
attgcatttatggcacctgaggtactaagaggtcagcagtatggtaggagctgtgatgta
tggagtgttggctgtgccattatagaaatggcttgtgctaaaccaccttggaatgcagaa
aaacactccaatcatcttgctttgatatttaagattgcaagtgcgactactgctccatcg
atcccttcacatttgtctcctggtttacgagatgtggctcttcggtgtttagaacttcag
cctcaggacagacctccatcaagagagctactgaagcatccagtcttccgtactacgtgg
tag

DBGET integrated database retrieval system