KEGG   Ailuropoda melanoleuca (giant panda): 100466468
Entry
100466468         CDS       T01329                                 

Gene name
ABL1
Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04110  Cell cycle
aml04360  Axon guidance
aml04722  Neurotrophin signaling pathway
aml05200  Pathways in cancer
aml05206  MicroRNAs in cancer
aml05220  Chronic myeloid leukemia
aml05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100466468 (ABL1)
   04014 Ras signaling pathway
    100466468 (ABL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100466468 (ABL1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100466468 (ABL1)
  09158 Development and regeneration
   04360 Axon guidance
    100466468 (ABL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100466468 (ABL1)
   05206 MicroRNAs in cancer
    100466468 (ABL1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100466468 (ABL1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100466468 (ABL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100466468 (ABL1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100466468 (ABL1)
Protein kinases [BR:aml01001]
 Non-receptor tyrosine kinases
  ABL family
   100466468 (ABL1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 Kinase-like SH3_6
Other DBs
NCBI-GeneID: 100466468
NCBI-ProteinID: XP_002915254
Ensembl: ENSAMEG00000016250
UniProt: D2H177
LinkDB
Position
7
AA seq 1150 aa
MGQQPGKVLGDQRRPSLPALHFIKGAGKKESSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKKGVRGVAST
LLQAPELPTKTRTSRRAVEHKDPTDVPDTPHSKGLGETDPLDHEPPVSPLLPRKERGPQD
GGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERKAASEEEGRET
SNGGPALTPSDTAEPAKSPKPSSGAGVPNGAFRETGGAGFRSPHLWKKSSTLTSSRLAAS
EEESGSSSSKRFLRSCSASCVPHGARDTEWKSVTLPRDLQSTGRQFDSSTFGGHKSEKPA
LPRKRASENRSDQVTRGTVTPPPRLVKKTEDAADEVFRDTGESSPGSSPPSLTPKLLRRQ
VAGTPSSGLPHKDEAGKSGALGTPATAEPVPPASRAGPGTSGGASKASTEEPRARRHKPS
SESPGRDKGKLSKLKPVPPPPPPASVGKAGKPSQNLSQEAAGEAGTGGKAKATAVVVDAV
NSDTVKPGPLGEGVKKPVLPSMPKPQSSSKPAGTPTSPAPTPSTVPSASSALAGDQPAST
AFIPLISTRVSLRKTRQPPERIASGTITKGVVLDGTEALCLAISKNSEQMASHSAVLEAG
KNLFTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSS
VKEISDIVQR
NT seq 3453 nt   +upstreamnt  +downstreamnt
atggggcagcagcctggaaaagttcttggggaccagagaaggccaagtttgcctgccctg
cactttatcaaaggagcagggaagaaggaatcatcaaggcatgggggtccacactgcaat
gtttttgtggaacatgaagcccttcagaggccagtagcatccgactttgagccccaaggt
cttagtgaagcagctcgttggaactccaaggaaaaccttcttgctggccccagtgaaaat
gaccccaaccttttcgttgcactgtatgatttcgtggccagtggggacaacaccctaagt
ataactaaaggtgaaaagctccgggttttaggctacaatcacaatggggaatggtgtgaa
gcccaaaccaaaaatggccaagggtgggtcccaagcaactacatcacaccagtcaacagt
ctggagaaacattcctggtaccatgggcctgtgtcccgcaacgcggccgaatacctgctg
agcagtgggatcaacggcagcttcttggtccgagagagcgagagcagtcctggccagagg
tccatctcgctgagatacgaagggagggtgtaccactacaggatcaacactgcttccgat
ggcaagctctacgtctcctcagagagccgcttcaacactttggctgagctggttcatcat
cactcgactgtggcggacgggctcatcaccactctccattacccggcccccaagcgcaac
aagcccaccgtctacggcgtgtcccccaactacgacaagtgggagatggagcgcacggac
atcaccatgaagcacaagctgggtggaggccagtacggggaggtgtacgaaggcgtgtgg
aagaaatacagcctgacggtggctgtgaagaccttgaaggaggacaccatggaggtggaa
gagttcttgaaagaagccgcagtaatgaaagagatcaagcaccccaatctagtgcagttg
ctcggggtctgcacccgggaacccccattctatataatcactgagttcatgacctatggg
aacctgctggattacctgagagagtgtaaccggcaggaggtgaacgctgtggtgctgctg
tacatggccactcagatctcgtctgccatggagtacctggagaagaagaacttcatccac
agagatctcgctgcccgaaactgcctggtcggggagaaccacttggtgaaggtggctgat
tttggcctgagcaggttaatgaccggggatacctacacagcccatgctggggccaagttc
ccgatcaagtggacggcgccggagagcctggcctacaataagttctccatcaagtccgac
gtctgggcttttggagtattgctttgggaaattgctacctatggcatgtcaccttaccca
ggaattgacctgtcccaggtgtatgagctgctagagaaggactaccgcatggagcgcccg
gaaggctgcccggagaaggtctacgaactcatgcgagcatgttggcaatggaatccctcc
gaccggccctcctttgctgaaatccaccaagcctttgagacaatgttccaggaatccagc
atatcagatgaagtggaaaaggaactggggaaaaaaggtgtgcgaggggttgcaagtact
ttactgcaggccccagagctgcccaccaagacaagaacctccaggagagctgtggaacac
aaagaccccactgatgtgcctgacacaccccactccaagggcctgggagagaccgatcct
ctggaccatgagcctcctgtgtctccgctgctccctcgaaaagaacgaggtccccaggat
ggcggcctaaatgaagatgagcgccttctccccaaagacaaaaagaccaacttgttcagt
gccttgatcaagaagaagaagaaaacagccccaacccccccgaaacgcagcagctccttc
cgggagatggatggccagcccgagcgcaaggcggccagtgaggaagagggccgagaaacc
agcaacggggggccagccctcacaccctcggacacagccgagccagccaagtccccgaag
cccagcagcggggctggtgtccccaatggagccttccgggagacagggggtgcaggcttc
cggtctccccacctgtggaaaaagtccagtacactgaccagcagccgcctggcagccagt
gaggaagagagcggcagcagctccagcaagcgcttcctaaggtcttgctctgcctcctgc
gtgccccacggggccagggacacagagtggaagtctgtcacactgcctcgggatctgcag
tccacggggaggcaattcgactcgtccacgtttggagggcacaaaagcgagaagccagct
ctgcctcggaagcgagcaagtgagaacaggtctgaccaggtgaccagaggcacagtgact
cccccgcccaggctggtgaaaaagaccgaggatgcagcggatgaggtcttccgagacacg
ggggagtccagcccgggctccagccctcccagtctgactccaaaactcctccgcaggcag
gtcgcggggactccttcctcgggccttccccacaaggacgaggctgggaagtccggtgcc
ttggggacacctgccacagctgagccggtgccccccgccagcagagcagggccaggcacg
tctggaggggccagtaaggcctccaccgaggagcccagagcgaggaggcacaagccctcc
tccgagtccccggggagagacaaggggaaactgtccaagctcaaacctgtcccgccaccc
ccgccaccagcctccgttgggaaagctgggaagccctctcagaacctgagccaggaagca
gctggggaggccggcactggtgggaaagccaaagccacggctgtggttgtggatgctgtg
aacagtgacaccgtcaagcccggtccgctgggagagggtgtcaaaaagcccgtgctccct
tccatgccaaagccacagtcgtccagcaagccggcggggaccccgaccagcccagctccc
accccttccaccgtgccatcagcatcctctgccctggccggggaccagccagcctccact
gccttcatccctctcatatcaacccgtgtgtctcttcggaaaacccgccagcctccggag
cggatcgccagtggcaccatcaccaagggcgtggtcctggacggcacagaggctctgtgc
ctggccatctccaagaactccgagcagatggccagccacagcgccgtgctagaagccggc
aagaacctgttcacgttctgcgtgagctatgtggattccatccagcaaatgaggaacaag
ttcgccttccgcgaggccatcaacaaactggagaacaatctccgggagcttcagatttgc
ccggcgacagcagggagcggcccggcggccactcaggacttcagcaaactcctcagctcc
gtgaaagagatcagtgacattgtgcagaggtag

KEGG   Ailuropoda melanoleuca (giant panda): 100468203
Entry
100468203         CDS       T01329                                 

Gene name
BCR
Definition
(RefSeq) breakpoint cluster region protein
  KO
K08878  breakpoint cluster region protein [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05200  Pathways in cancer
aml05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aml00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100468203 (BCR)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100468203 (BCR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100468203 (BCR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100468203 (BCR)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100468203 (BCR)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: Other
  BCR family
   100468203 (BCR)
Membrane trafficking [BR:aml04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    100468203 (BCR)
SSDB
Motif
Pfam: RhoGAP RhoGEF PH_19 C2 PH IQ_SEC7_PH PH_5
Other DBs
NCBI-GeneID: 100468203
NCBI-ProteinID: XP_034498072
Ensembl: ENSAMEG00000008979
LinkDB
Position
14
AA seq 1186 aa
MPCGSCCITHSKTTAPGAVGTQLLLALECRTRQGLGVGRASAAADREDRGPPTSVAALRS
NFERIRKGHGQPGAADTEKPFYVNVEFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKS
QHSSGQGLGDAPRPSYRGRSSESSCGLDGDYEDAELNPRFLKDNLINANGGSRPPWPPLE
YQPYQSIYVGGMMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDSGGGYTPDCSS
NENLTSSEEDFSSGQSSRVSPSPTTYRMFRDKSRSPSQNSQQSFDSSSPPTPQCQKRHRQ
GQVIVSEATIVGVRKTGQIWPSDGDSLSSRLPQDGTFHGDADASFGTPPGFGCAADRAEE
QRRHQDGLPYIDDSPSSSPHLGSKGRGSRDTPAPGALESTKASELDLEKGLEMRKWVLSG
ILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLF
PRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMETAEKCCQANTQFAEISENLRAR
SNKDAKDQTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPSSHPDHPLLQDALRISQNFL
SSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSG
GKTQQYDCKWYIPLTDLSFQTVDESEAAPNIPLVLDEELDAMKIKISQIKNDIQREKRAN
KGSKAIERLKKKLSEQESLLLLMSPSMAFRVHNRNGKSYTFLISSDYERAEWRENIREQQ
KKCFKSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLYGFLNVIVHSATGFKQ
SSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNEEFEIELEGSQTLRILCYEKCYNKTK
ITKEDGESTDRIMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSIKFTSREFSLKRMPS
RKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAF
DVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCML
NLLLSLPEANLLTFLFLLDHLKRVAEKETVNKMSLHNLATVFGPTLLRPSEKESKVPANP
SQPISMTDSWSLEVMSQVQVLLYFLQLEAIPAPDSKRQSTLFSTEV
NT seq 3561 nt   +upstreamnt  +downstreamnt
atgccctgtggcagctgttgcatcacccactccaagaccacagcgccgggggccgttggc
acacagctgctactggctttggagtgcagaactcgccagggcctcggcgtcggacgggcc
tccgcggccgcggaccgtgaagaccggggcccccccaccagcgtggcggcgctcaggtcc
aactttgagaggatccgcaagggccacggccagcccggggcggcggacaccgagaagccc
ttctacgtgaacgtagagtttcaccacgagcgcggcctggtgaaggtcaacgacaaagag
gtgtcggaccggatcagctccctgggcagccaggcgatgcagatggagcgtaagaagtcc
cagcacagcagcggacagggcctgggggacgcgcccaggccctcttaccggggccgctcc
tcggagagcagctgcggcctcgacggcgactacgaggacgcggagctgaacccccgattc
ctgaaggacaacctgatcaacgccaatggcggcagcaggcccccttggccgcccctggag
taccagccctaccagagcatctacgtggggggcatgatgatggaaggggagggcaagggc
ccgctcctgcgcagccagagcacctcggagcaggagaagcgccttacctggccccgcagg
tcctactcccctcggagctttgaggacagcggaggcggctacaccccggactgcagctcc
aatgagaacctcacctccagcgaggaggacttctcctcgggccagtccagccgcgtgtcc
cccagccccaccacctaccgcatgtttcgagacaagagccgctcaccctcgcagaactca
cagcagtcctttgacagtagcagccccccgacgccgcagtgccagaagcggcaccggcag
ggccaggtcatcgtgtcggaggccaccatcgtgggcgtccgaaagacggggcagatctgg
cccagcgatggagacagcttgtccagcaggctgcctcaggatggcaccttccatggagat
gcagatgcgtcgtttggaacaccacctgggttcggctgtgctgcagaccgggctgaagag
cagcgccggcaccaggacgggctgccctacatcgatgactcgccctcctcctcaccccac
cttggcagcaagggcaggggtagtcgggacacaccggccccgggagccctggagtccacc
aaagcgagtgagctggacttggagaagggcttggagatgaggaaatgggtcctgtctgga
atcctggccagcgaggagacttacctgagccacctggaggcactgctgctgcccatgaag
cctttgaaggctgctgccaccacctctcagccagtgctgacaagccagcagatcgagacc
atcttcttcaaagtgcctgagctctacgagatccacaaggagttctatgacgggctcttc
ccccgcgtgcagcagtggagccaccagcagcgagtgggtgatctcttccagaagctggcc
agccagctgggtgtgtaccgagcctttgtagacaactacggagttgccatggaaacggct
gagaagtgctgtcaggccaacactcagtttgcagaaatctctgagaaccttagagccaga
agcaacaaggatgccaaggaccagacgaccaagaactctttggaaaccctgctctacaag
cctgtggaccgggtgacacgcagcacactggtcctgcatgacttgctgaagcacacgccc
tccagccaccccgaccaccctctgctacaggatgccctccgtatctcacagaacttcctg
tccagcatcaacgaggagatcacgccccgccggcagtccatgaccgtgaagaagggagag
caccggcagctgctgaaggacagcttcatggtggagctggtggagggggcccgcaagctg
cgccacgtcttcctgttcaccgacctgctcctctgcaccaagctcaagaagcagagtgga
ggcaaaacccagcagtatgactgcaagtggtacatcccactcacggatctcagcttccag
acggtagatgagtcagaggcagctcccaacatccccctggtgctggacgaggagctggat
gccatgaagatcaagatatcccagatcaagaatgatatccagagagagaagagggcaaac
aagggcagcaaggccatcgagaggctgaagaagaagctgtcagagcaggagtcactactc
ttgctcatgtcccccagcatggccttcagggtgcacaaccgcaacggcaagagttacaca
ttcctgatctcctctgactatgagcgcgctgagtggagggagaacatccgagagcagcag
aagaagtgtttcaaaagcttctccctgacatccgtggagctgcagatgctgaccaattcg
tgtgtcaaacttcagaccgtccacagcattccactgaccatcaacaaggaagatgatgaa
tcaccggggctgtacggattcctgaacgtcattgtccactccgccactggctttaagcag
agttcaaatctgtactgcaccctggaggtggactcctttggttattttgtgaataaagcc
aagacacgcgtttacagagacacagcggagcccaactggaacgaggaattcgagattgag
ctggaaggctcccagaccttgaggatactgtgctatgaaaagtgttacaacaaaacgaaa
atcaccaaggaggatggcgagagcacagacaggatcatggggaagggccaggtccagctg
gacccccaggccctgcaggacagagactggcagcggactgtcatcgccatgaatgggatt
gaagtgaaactctccatcaagttcaccagcagggagttcagcttgaagagaatgccttcc
cgaaaacagacgggcgtcttcggagtcaagattgctgtggtcaccaagagggagagatcc
aaggtgccctacatcgtgcgccagtgcgtggaggagattgagcgccggggcatggaggaa
gtgggcatctaccgtgtgtctggagtggccacggacatccaggcgctgaaggcggccttt
gacgtcaataacaaggacgtgtcggtgatgatgagcgagatggatgtgaatgccattgcc
ggaacactgaaactgtacttccgcgagctgccggagcccctcttcaccgacgagttctac
cccaacttcgccgagggcatcgctctgtcagaccctgttgcaaaggagagctgcatgctt
aacttgctgctgtcactcccagaggccaacctgctgaccttcctcttccttctagatcac
ctgaaaagggtggcggaaaaggagacagtgaacaagatgtccctgcacaaccttgccaca
gtcttcggccccacgctgctccggccatcagagaaggagagcaaggtccctgccaacccc
agccagcccatatccatgaccgacagctggtccctggaagtcatgtcccaggtccaggtg
ctactgtacttcctgcagctggaggccatccctgccccagacagcaagaggcagagcacc
ctattctccactgaagtctaa

DBGET integrated database retrieval system