KEGG   Ailuropoda melanoleuca (giant panda): 100466561
Entry
100466561         CDS       T01329                                 

Gene name
TFG
Definition
(RefSeq) protein TFG isoform X1
  KO
K09292  protein TFG
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05200  Pathways in cancer
aml05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100466561 (TFG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100466561 (TFG)
SSDB
Motif
Pfam: PB1
Other DBs
NCBI-GeneID: 100466561
NCBI-ProteinID: XP_034513476
Ensembl: ENSAMEG00000003873
LinkDB
Position
1
AA seq 401 aa
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DSLEPPGEPGPSTNIPENDTVDGRDEKPAASDSSGKQSTQVMAASMSAFDPLKNQDEINK
NVMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQS
EGQMYQQYPQQAGYGAQQPQAPPQPPQQYGIQYSAGYSQQTGPQQPQQFQGYGQQPASQA
PAPAFAGQPQQLPAQPAQQYQASSYPPQTYTTQTSQPTNYTVAPASQPGMAPSQPGAYQP
RPGFTPPPGSTMTPPPSGPNPYARTRPPFGQGYTQPGPGYR
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgaatggacagttggacctaagtgggaagctaatcatcaaagctcaacttggggaggat
attcgacgaattcccattcataatgaagatattacttatgatgaattagtgctaatgatg
cagcgagttttcagaggaaaactcctcagtaatgatgaagttacaataaagtataaagat
gaagatggagatcttataacaatttttgatagttctgacctttcttttgcaattcagtgt
agtaggatactgaaactgacattatttgttaatggccaaccaagaccccttgaatcgagt
caagtgaagtatctccgtcgagagctgatagaactgcgaaataaagtgaatcgcttgttg
gatagcttggaaccacctggagaaccaggaccttccaccaatattcctgaaaatgatact
gtcgatggtagggatgaaaagcctgctgcttctgattcttctggaaaacagtctactcag
gttatggcagcaagtatgtcagcttttgatcctttaaaaaaccaagatgaaatcaataaa
aatgtcatgtcagcgtttggcttaacagatgatcaggtttcagggccacccagtgctcct
gcagaagaccgttcaggaacacccgacagcattgcttcctcctcctctgctgctcatcca
ccaggagttcagccccagcagccaccctatacaggagctcagacacaagcaggtcagagt
gaaggtcagatgtaccagcagtacccgcaacaggccggctacggtgcccagcagccacag
gcgccccctcagccaccccagcagtacggtattcagtattcagcaggctatagtcagcag
actggaccccaacaacctcagcagttccagggatatggccagcaaccagcttcccaggca
ccggctcctgcctttgctggccagcctcagcagctgcctgctcaaccagcacagcagtac
caggcgagcagttaccctccacaaacttacactacccagacttctcagcctaccaattat
actgtggctcctgcctcacaacctggaatggctccaagccaacccggggcctatcaacca
agaccaggttttactccacctcctggaagtactatgactccgcctcctagtgggcctaac
ccttatgctcgcactcgccctccctttggtcagggctatacccaacctggacctggctat
cgataa

KEGG   Ailuropoda melanoleuca (giant panda): 100480868
Entry
100480868         CDS       T01329                                 

Gene name
TPR
Definition
(RefSeq) nucleoprotein TPR isoform X5
  KO
K09291  nucleoprotein TPR
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03013  RNA transport
aml05014  Amyotrophic lateral sclerosis
aml05200  Pathways in cancer
aml05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100480868 (TPR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100480868 (TPR)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100480868 (TPR)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100480868 (TPR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:aml03019]
    100480868 (TPR)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100480868 (TPR)
SSDB
Motif
Pfam: TPR_MLP1_2 Seryl_tRNA_N TFIIA DUF5082 DUF1192 Imm70
Other DBs
NCBI-GeneID: 100480868
NCBI-ProteinID: XP_002924887
Ensembl: ENSAMEG00000015423
LinkDB
Position
8
AA seq 2439 aa
MPSSGSVSRSRQRGRPMASRSFDGSRRGSLRRAGAREPRSEVAEAAAQASGSSWSSPFFS
VWAPPAAGPAASGPIDMAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHE
KFKVESEQQYFEIEKRLSHSQERLVNETRECQSLRLDLEKLNNQLKALTEKNKELEVAQD
RSVAIQSQFTRTKEELEAEKRDLVRTNERLSQELEYLTEDFKRQNEKLKESNATKGDLQL
KLDELQASDVSVKYREKRLEQEKELLHNQNTWLNTELKTKTDELLALGREKGNEILELKC
NLENKKEEVSRMEEQMNGLKTSNENLQKHVEELLTKLKEAKEQQASMEEKFHNELNAHIK
LSNLYKSAADDSEAKSNELTRAVDELHKLLKEAGEANKAIQDHLLEVEESKDQMEKEMLE
KIGELEKELQNANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVE
TQDQLLLEKLENKRINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKE
IQRLQEDTDKANKHSSVLERDNQRMEIQIKDLSQQIRVLLMELEEARGNHVIRDEEVSSA
DISSSSEVISQHLVSYRNIEELQQQNQRLLVALRELGETREREEQETTSSKIAELQLKLE
NALTELEQLRESRQHQMQLVDSIVRQRDMYRILLSQTTGVAIPLQASSLDDISLASTPKR
SSTSQTASTPAPVPVIESAEAIEAKAALKQLQEIFENYKKEKADNEKIQNEQLEKLQDQI
TDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMT
QDLRGANEKLAVAEVRAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQG
ILERSETETKQRLSSQIEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTET
NLHLNTKELLKNAQKEIATLKQHLSNMEVQLASQSSQRTGKGQPTNKEDVDDLLSQLRQA
EEQANDLKERLKTSTSNVEQYRAMVTSLEESLNKEKQVTEEVRKNIEVRLKESAEFQTQL
EKKLMEVEKEKQELQDDKRKAIESMEQQLSELKKTLNSVQNEVQEALQRASTALSNEQQA
RRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKAESQL
LECKASWEERERMLKDEVSKCMSRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNV
SLNEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNA
EREKVQVTAKTMAQHEELMKKTETMNVVMETNKMLREEKERLEQDLQQMQAKVRKLELDI
LPLQEANAELSEKSGMLQAEKKLLEEDVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVH
TKRIQQLTEEIGRLKAEIARSNASLTNNQNLIQSLKEDLNKVRTEKETIQKDLDAKIIDI
QEKVKTITQVKKIGRRYKTQYEELKAQQDKVMETSAQSSGDHQEQHVSVQEMQELKETLN
QAETKAKSLESQIENLQKTLSEKEAEARNLQEQTVQLQSELSRLRQDLQDRTTQEEQLRQ
QITEKEEKTRKAIVAAKSKIAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRMTALKS
QYEGRISRLERELREHQERHLEQRDEPQEPTNKVPEQQRQITLKTTPASGERGIASTSDP
PTANIKPTPVVSTPSKVTAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVE
SQEAMQSEGPVEHVPVFGSTSGSVRSTSPNVQPSIPQPILTVQQQTQATAFVQPTQQSHP
QIEPANQELSPNIVEVVQSSPVERPSTSTAVFGTVSATPSSSLPKRTREEEEDSTIEASD
QVSDDTVEMPLPKKLKSVTPVGTEEEVMAEESTDGEVETQVYNQDSQDSIGEGVTQGDYT
PMEDSEETSQSLQIDLGPLQSDQQTTTSSQDGQGKGDDVIVIDSDDEEEDDDENDGEHED
YEEDEEDDDDDEDDTGMGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGG
GESNQRAADSQNSGEGNTGTAESSFSQDISREQQPSSASERQTPRAPQSPRRPPHPLPPR
LTIHAPPQELGPPVQRIQMTRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVPH
RTDGFAEAIHSPQVAGVPRFRFGPPEDMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEE
ESGGRSVPTTPLQVAAPVTVFTESTTSDASEHASQSVPMVTTSTGTLSTTNETATGDDGD
EVFVEAESEGISSEAGLEIDSQQEEEPVQASDESDLPSTSQDPPSSSSVDTSSSQPKPFR
RVRLQTTLRQGVRGRQFNRQRGVSHAMGGRGGINRGNIN
NT seq 7320 nt   +upstreamnt  +downstreamnt
atgccctctagtggctcagtgtctagaagccgccaaagaggacgacccatggcatcccgg
agctttgacgggtcccgccgcgggagtctccggcgggcgggcgcacgcgagcctcggagc
gaggtggccgaggcggccgcccaggcttctgggtcctcttggtcttcgcctttcttctcg
gtgtgggctccgccggctgctggccctgcggcctccggcccgattgacatggcggcggtg
ttgcagcaagtcctggagcgcacggagctgaacaagctgcctaagtccgtccagaacaaa
cttgaaaagttccttgctgaccagcaatccgagatcgatggcctgaaggggcggcatgag
aaatttaaggtggagagtgaacaacagtattttgagatagagaagaggctgtcccacagt
caggagagacttgtgaatgaaacccgagagtgccaaagtttgaggcttgacctagagaag
ctcaacaatcaactgaaggcgctaactgagaaaaataaagaacttgaagttgctcaggat
cgcagtgttgccattcagagccagtttacaaggacgaaagaagaattagaagctgagaaa
agagacttagttagaaccaatgagagactatctcaagaacttgaatatttaacagaggat
tttaaacgtcaaaatgaaaaacttaaagaaagcaatgccacaaagggtgatctgcagtta
aaactggatgaacttcaagcttctgatgtttctgttaaatatcgagaaaaacgcttggag
caagaaaaggagttgttacataatcagaatacatggctgaacacagagttaaaaactaaa
accgatgaacttctggctcttggcagagaaaaaggaaatgagattctagagcttaaatgt
aatcttgaaaacaaaaaagaggaggtttctagaatggaagaacagatgaatggcttgaaa
acatcaaatgagaatcttcaaaagcatgtagaagagctattgaccaaactgaaagaggcc
aaggaacagcaggccagtatggaagagaaattccacaatgaattaaatgctcatataaag
ctctctaatctatacaagagtgctgccgatgactcagaagcaaagagcaatgaactgacc
cgagcagtggatgaactacacaaacttttgaaagaagctggagaagccaataaagcaata
caggatcatcttttagaagtggaggaatctaaagatcaaatggaaaaagaaatgcttgag
aaaataggggaattggagaaggaattacagaacgcaaatgacctgctttctgccacaaaa
cgtaaaggagctatattatctgaagaagagcttgcagctatgtctcctactgcagcagct
gtagctaagatagtgaagcccggcatgaaattaaccgagctgtataatgcttatgtggaa
actcaggatcagttgcttttggagaaactagagaataaaagaattaataagtatctagat
gaaatagtgaaagaagttgaagccaaagcaccaattttgaaacgccagcgtgaggagtat
gaacgtgcacagaaagctgtggcaagtttatctgttaagcttgaacaagctatgaaggag
attcagcgattgcaggaggacactgataaagctaacaaacattcatctgtgcttgaaaga
gacaatcaaaggatggaaatacaaataaaagatctttcacaacagattagagtgcttttg
atggaacttgaagaagcaaggggtaatcatgtaattcgtgatgaagaagtaagctctgct
gatataagtagttcatctgaagtaatatcacagcatctagtatcttatagaaatattgaa
gaacttcaacagcaaaatcagcgtctcttagtggcccttagggaacttggggaaacgaga
gaaagagaagaacaagaaacaacttcatctaaaattgctgagcttcagctaaaacttgag
aatgccctcactgaattagaacaactccgtgagtcacgacaacatcaaatgcagcttgtt
gattccatagttcgtcagcgtgacatgtaccgtattttgttgtcacaaacaacaggagtt
gccattcctttacaagcttcaagcttagatgatatttctcttgcatcaactccaaaacgt
tcaagtacgtcccagactgcttccactcctgctccagtacctgtaattgagtcagcagag
gccatagaagccaaggctgcccttaaacagttgcaggaaatttttgagaattacaaaaaa
gaaaaggcagataatgaaaaaatacaaaatgagcaacttgagaaacttcaggatcaaatt
acagatttacgatcacaaaacaccaaaatttctacacagctggactttgcttctaaacgt
tacgaaatgctacaagataacgttgaaggatatcgtcgagaaatcacatccctacatgag
agaaatcagaaactcactgcaacaactcaaaagcaggaacagatcatcaatacaatgacg
caggatttgagaggagcaaatgaaaagctagctgttgcggaagtaagagcagaaaacttg
aaaaaggaaaaggaaatgcttaaattgtcagaagtccgtctttctcagcaaagggagtct
ttattagctgaacaaagagggcaaaacttgctgctcactaatctgcaaacaattcaggga
atattagagcgatctgaaacagaaaccaaacaaaggcttagtagccagatagaaaaactg
gaacatgagatatctcatctaaagaagaagctggaaaatgaggtggaacaaaggcatacg
ctcactagaaatctagatgttcaacttttagatacaaagagacagctggatactgagaca
aatcttcatcttaacacaaaagaactattaaaaaatgctcaaaaggaaattgctacattg
aaacagcacctcagtaatatggaagtccagcttgcctctcagtcctcacagagaactggt
aaaggtcagcccaccaacaaagaagatgtggatgatcttctaagtcagctaaggcaggca
gaggagcaggcgaatgatttaaaggagagactcaaaacaagtactagtaatgtggaacag
tatcgagcaatggttactagtttagaagaatctcttaacaaggaaaaacaggtgacagaa
gaagtacgtaagaatattgaagttcgtttaaaagagtcagcggaatttcagacacagttg
gaaaagaaattgatggaagttgagaaggaaaaacaggaacttcaggatgacaagagaaaa
gccatagagagcatggaacaacagttatctgagttaaagaaaacactcaacagcgttcag
aacgaagtacaagaagctcttcagagagcaagcacagctttgagtaatgagcagcaagcc
agacgtgactgtcaggaacaggctaaaatagctgtggaagctcagaataagtatgagaga
gaactgatgctacatgctgctgatgttgaagctctacaagctgccaaggaacaggtttcc
aaaatggcatcagtccgtcagcatttggaagaaacaacccagaaagcagaatcacagtta
ctggagtgtaaagcatcttgggaggaaagagagagaatgttaaaggatgaagtttccaag
tgtatgtctcgctgtgaagatttggagaaacaaaacagattacttcatgatcagattgaa
aaattaagtgacaaggttgtcgcctctgtgaaggaaggtgtacaaggtcccttgaatgta
tctcttaatgaagaaggaaaatctcaagaacaaattctagaaattctcagatttatacga
cgagaaaaagaaatcgctgaaaccaggtttgaggtggctcaggttgagagtctgcgttat
cgacaaagagttgagcttttagaaagagaactgcaggaactgcaggatagtctgaatgct
gaaagagagaaagtccaggtaactgcaaaaacaatggctcagcatgaagaactgatgaag
aaaactgaaacaatgaatgtagtgatggagaccaataagatgctaagagaagagaaagag
aggctggaacaggatctacagcagatgcaagcaaaggtaaggaaactggagttagatatt
ttacccttacaagaagcaaatgctgagctaagtgaaaaaagcggtatgttgcaagcagag
aagaagttactagaagaagatgtcaaacgttggaaagcacggaaccagcatctagtaagt
caacagaaagatccagatacagaagaatatcggaagctcctttctgaaaaggaagttcat
actaagcgtattcaacagttgactgaagaaattgggagacttaaagctgagattgcaaga
tcaaatgcatctttgaccaacaatcagaacttaatccagagcctgaaggaagacttaaat
aaagtaagaactgaaaaggaaaccattcaaaaggacttagatgccaaaataattgatatc
caagaaaaggtcaaaactattactcaagtcaagaagattgggcgtaggtacaagactcaa
tatgaagaacttaaagcacaacaggataaggtcatggagacctcggctcagtcttctgga
gaccaccaggaacagcatgtctcagttcaggaaatgcaggagcttaaagaaaccctcaat
caagctgaaacaaaggcaaaatcactagagagtcaaatagaaaatctgcagaagacatta
tccgaaaaagaggcagaagcaagaaatctgcaggagcaaactgtgcagcttcagtctgag
ctttcacgacttcgtcaggatcttcaagatagaaccacacaagaggagcagctccgacag
cagataactgaaaaggaagaaaaaacaagaaaggccatagtagcagcaaagtcaaagatt
gcacatttagctggtgtaaaagatcagctaactaaagaaaatgaggagcttaaacaaagg
aatggagccttagatcagcagaaagatgaattggatgttcgaatgactgctcttaaatcc
cagtatgaaggtcgaattagtcgcttggaaagagaactccgagagcatcaagagagacac
ctggagcagagagatgagcctcaagaacctactaataaggtcccagaacagcagagacag
atcacattgaaaacaactccagcttctggtgaaagaggaattgccagcacatcagaccca
ccaacagccaatatcaaaccaactcctgttgtgtctactccaagtaaagtgacagctgca
gctatggctgggaataagtcaacacccagagctagtatccgcccaatggtcacacctgca
actgttacaaatcctactactaccccaacagcgacagtgatgcccactacacaagtagag
tcacaggaagctatgcagtcagaagggcctgtggaacatgttccagtttttggaagcaca
agtggttctgtccgctctactagtcctaacgtccagccttctatccctcaacccatttta
actgttcagcaacaaacacaggctacagcttttgtgcagcccacccaacagagtcatcct
cagattgagcctgcaaatcaagagctgtcccccaacatagtagaagttgtacagagttca
ccagttgaacggccttctacttccacagcagtatttggcactgtgtcagctaccccaagt
tcttctttgcctaaacggacacgtgaagaggaagaggatagcaccatagaagcatcagac
caagtctctgatgatacagtggaaatgcctcttccaaagaagttgaaaagtgttacccct
gtaggaactgaggaagaagttatggcagaagaaagtactgatggagaggtagaaactcaa
gtatacaaccaagattctcaagattccataggagaaggagttacccagggagattatact
ccaatggaagacagtgaagaaacctctcagtctctacaaatagaccttggaccccttcag
tcagatcagcaaacaacaacttcgtcccaagatggtcagggcaaaggagatgatgtcatt
gtgattgacagtgatgatgaagaagaggatgatgatgaaaatgatggagaacatgaggat
tatgaggaagatgaggaagatgatgacgatgatgaagatgacacagggatgggagacgag
ggtgaggacagtaacgaaggcactggtagtgcagatggcaatgatggctatgaagctgat
gatgccgagggtggtgatgggactgatccaggtacagaaacagaagaaagtatgggtgga
ggtgaaagtaatcagagagctgctgattctcaaaacagtggtgaaggtaatacaggtact
gcagagtcctctttttcccaggacatttctagagaacagcagccatcatcagcatctgaa
agacagactcctagagcacctcagtctccaagacgccctccacaccctcttcccccacga
ctgaccattcatgctccacctcaagaattgggaccaccagtacagagaattcagatgact
cggaggcagtctgtaggacggggacttcagttgactccaggaatcggtggcatgcagcag
catttttttgatgatgaagacagaacagttccaagtactccaactcttgtggtgccacat
cgtactgatggatttgctgaagcaattcattccccacaggttgctggtgttcctagattc
cggtttgggccacctgaagatatgccacaaacaagttcaagtcactctgatcttggccag
cttgcttctcaaggaggtttaggaatgtatgaaacacccctcttcctagctcatgaagaa
gagtcaggtggccgaagtgttcccactacccctctacaggtagcagccccagtgactgtg
tttactgagagtaccacctctgatgcttcggagcatgcctctcagtctgttccaatggtg
acaacatccactggcactttatccacaacaaatgaaacagcaacaggtgatgatggagat
gaagtatttgtggaggcagaatctgaaggtattagttcagaagcaggcctagaaattgat
agccagcaggaagaagaacctgttcaggcatctgatgagtcggatcttccttctacaagc
caggatcctccatccagctcttctgtagatactagcagtagtcaaccaaagcctttcaga
cgagtcagacttcagacaacattgagacaaggtgtccgtggtcgtcagtttaacagacag
agaggtgtgagccatgcaatgggagggagaggaggaataaatagaggaaatattaattaa

KEGG   Ailuropoda melanoleuca (giant panda): 100482767
Entry
100482767         CDS       T01329                                 

Gene name
TPM3
Definition
(RefSeq) tropomyosin alpha-3 chain isoform X7
  KO
K09290  tropomyosin 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04260  Cardiac muscle contraction
aml04261  Adrenergic signaling in cardiomyocytes
aml05200  Pathways in cancer
aml05216  Thyroid cancer
aml05410  Hypertrophic cardiomyopathy
aml05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100482767 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    100482767 (TPM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100482767 (TPM3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100482767 (TPM3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100482767 (TPM3)
   05414 Dilated cardiomyopathy
    100482767 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aml04812]
    100482767 (TPM3)
Cytoskeleton proteins [BR:aml04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     100482767 (TPM3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd CENP-F_leu_zip WES_acyltransf DUF745 DUF1664 BORCS7 EzrA Lebercilin MAD Crescentin Fib_alpha
Other DBs
NCBI-GeneID: 100482767
NCBI-ProteinID: XP_002922540
Ensembl: ENSAMEG00000011877
LinkDB
Position
8
AA seq 248 aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAE
EADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQ
KEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQ
TLLDLNEM
NT seq 747 nt   +upstreamnt  +downstreamnt
atggccggtatcaccaccatcgaggcggtgaagcgcaagatccaggttctgcagcagcaa
gccgatgacgcagaggagagggccgagcgcctgcagcgggaagtggaaggggaaaggcgg
gcccgggagcaggctgaggctgaagtggcctccttgaaccgtaggatccagctggttgaa
gaggagctggaccgcgcccaggagcgcctggccactgccctgcaaaagctggaggaagcg
gagaaagctgctgatgagagcgagagaggtatgaaggttattgagaaccgagccttaaaa
gatgaagaaaagatggaactccaggaaatccaactcaaagaggccaagcacattgcagaa
gaggcagatcggaagtatgaagaggtggcacggaagttggtgattattgagggggacttg
gaacgcacagaggaacgagctgagctggcagagtcccgttgccgggagatggatgagcag
atcagactgatggaccagaacctgaagtgtctgagtgctgctgaagaaaagtactctcaa
aaggaggacaaatacgaggaagagataaagattctcacggataaactcaaggaggcagag
acccgtgcggagtttgctgagagatcagtagccaagctggagaagacaattgatgatttg
gaagataagctgaaatgcaccaaagaggagcacctctgtacacaaaggatgctggaccag
actctgcttgacctgaatgagatgtag

DBGET integrated database retrieval system