KEGG   Ailuropoda melanoleuca (giant panda): 100466584Help
Entry
100466584         CDS       T01329                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00052  Galactose metabolism
aml00500  Starch and sucrose metabolism
aml01100  Metabolic pathways
aml04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100466584 (MGAM)
   00500 Starch and sucrose metabolism
    100466584 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100466584 (MGAM)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100466584 (MGAM)
    3.2.1.20  alpha-glucosidase
     100466584 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100466584
NCBI-ProteinID: XP_002921729
Ensembl: ENSAMEG00000014965
LinkDB All DBs
Position
Un
AA seq 1837 aa AA seqDB search
MEQKKENLSCNKKKEMARTKVKDFTTLEIMLSVLLLMVFIITIPLFVLSAKDSLESKDPG
TSTSPDSSACPVVNEVERINCIPDQPPTKATCDQRGCCWRPQGTISVPWCYYSTSHGYQM
EGDLVKTNAGFTAQLKRLTSPSLFGNDVNNVLLTAEYQTSNRFHFKLTDQSKDRYEVPHE
HVQPFRGDAASPLTYDVMVSKQPFSIKVIRRSNNRVLLDSGIGPLLFADQFLQLSTRLPS
ANVYGLGEHVHQQYRHDMNWKTWSMFARDTTPNGDGTNLYGTQTFFLCLEDASGLSFGVF
LMNSNAMEVTLQPAPAVTYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPTLPSYWTLGF
HLSRYDYGTLGSMKEVVDRNRAAGLPYDVQHADIDYMDERKDFTYDPVNFKGFPEFVKEL
HNNSQKLIIIVDPAISNNSSPSNPYGPYDRGSSVKIWVNASDGVTPLIGEVWPGNTVFPD
FTNPSCAVWWANEFELFYNQVEFDGIWIDMNELSNFVDGSVSGCYTSNLNYPPFTPRILD
GYLFSKSLCMDAVQHWGKQYDVHNLYGYSMAIATAEAVKTVFPNKRSFIITRSTFAGSGK
FAAHWLGDNSATWDDLRWSIPGMLEFNLFGIPMVGADICGFLLDTTEELCRRWMQLGAFY
PFSRNHNGQGYKAQDPAFFGADSLLLNSSRHYLTIRYTLLPYLYTLFYRAHSRGDTVARP
LLHEFYEDSNTWDVHQQFLWGPGLLITPVLDEGAEKVMAYMPDAIWYDYETGARVRWRKQ
RVEMELPGDKIGLHLRGGHIFPTQQPATTTVASRQNPLGLIIALDDNKEAKGELFWDDGE
TKDTVANQVYLFCEFSATQNSLDVKILQSTYKDPNNLVFKEIKILGIQEPTNVIVKHNGV
QSQVSPNVTYDSNLQVALIVGIDLILGEAYTVEWDLKIMDAEKIDCFPDESGASAENCNA
RGCVWEESTSPGVPFCYFVNDLYSVGDVQYDSRGATATISLKSSVYASALPSVPVTSLSL
RVTYHKNDMLQFKIYDPNNNRYEVPIPLNIPTVPSSTPESQLYDVLIKKNPFGIEIRRKS
TGTVIWDSQLLGFTFNDMFIRISTRLPSTYLYGFGETEHTAFRRDLNWHTWGMFSRDEPP
GYKKNSYGVHPYYMALEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTIGGILDFYVFLGP
TPELVTQQYTEMIGRPVMVPYWSLGFQLCRYGYENDSEIASLYDEMVAAQIPYDVQYSDI
DYMERQLDFTLSPKFMGFPALINRMKLDGMRVILILDPAISGNETQPYPAFTRGVEDDVF
IKAPNGGDIVWGKVWPDYPDVVINGSLDWDIQVELYRAYVAFPDFFRNSTITWWKRELQE
LYTNPQNPERSLKFDGMWIDMNEPSSFVNGAVPPGCKNASLNYPPYMPYLESRDRGLGSK
TLCMDSEQVLPDGSRVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWG
GHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCARWMQLGAFYPF
SRNHNTIGTRRQDPVSWDAAFVNMSRSVLQTRYTLLPYLYTLMHMAHTEGSTVVRPLLHE
FVSDRETWDIDSQFLLGPAFLVSAVLEPNARNVTAYFPRARWYDYYTGVDIGARGEWKSL
EAPLDHINLHVRGGYILPWQEPAQNTHLSRQKFIGFKVALDDEGTAKGWLFWDDGESIDT
YGEGRYYLANFSASQNMMQSHIIFNKYITDSNPLKLGYIEIWGVDSVSISSVSISVSGMV
ITPTFNYDPATQVLSIDVTSRDISLHNFISLTWGSTL
NT seq 5514 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaagaaggaaaacctcagctgcaataagaagaaagagatggcaagaacgaag
gtgaaagatttcacgactttggagattatgctcagtgttcttctgcttatggtgtttatc
atcactattcctctgtttgtgctttcagctaaagattctttggaatcaaaagatcctggg
acaagtaccagccctgattcatctgcgtgcccagtggtaaatgaagtggaacggataaac
tgcatccctgaccagccaccaacaaaggccacatgtgatcagcgtgggtgctgctggaga
cctcaggggaccataagtgtgccctggtgctactattctacaagtcatggttaccagatg
gagggtgaccttgtaaaaacaaatgcaggattcacagcccagttgaaaagattgacttct
ccatccctatttggaaatgatgtcaacaatgtccttctcacagcagaataccagacgtcc
aatcgtttccattttaagctgactgaccagagcaaggacaggtacgaagtacctcatgag
cacgtgcaacccttcagaggagacgctgcgtctcccttgacttacgacgtcatggtctcc
aaacagccatttagcatcaaagtgatcagaagaagcaataatcgtgttctgttggactca
ggcatcggacccctcctgtttgctgatcagttcctgcagctctccacccgactgcccagt
gcgaacgtgtacggtctgggagaacacgtgcaccaacagtaccggcatgatatgaattgg
aagacctggtccatgtttgccagggacacaacacccaatggggatggaactaacttgtat
ggaacacagacattcttcctgtgtcttgaagatgctagtggattgtcttttggagtgttt
ctgatgaacagcaatgccatggaggttaccctccagcccgccccagccgtcacttaccgc
accatcgggggcattctcgacttctatgtgtttttgggaaacactccagagcaagttgtt
caagagtatctagagctcattggaaggccaacccttccctcatactggacacttggattt
cacctcagtcgttatgattatggaacactagggagcatgaaggaagtcgtggacagaaac
cgtgcagcaggactcccttacgacgttcagcatgccgatattgattatatggatgagagg
aaggacttcacttatgatccagtcaattttaaaggcttccctgagtttgttaaggagtta
cacaataacagtcagaaattaatcatcattgtggatccagccatctccaacaactcttcc
cccagcaacccttatggcccgtatgacaggggttccagcgtgaagatatgggtgaatgct
tcagatggggtgactccactcattggggaggtctggcctggaaacactgtgtttcctgat
tttaccaaccccagctgtgctgtttggtgggcaaatgaattcgagctattctacaaccaa
gtagagtttgatggaatctggattgatatgaatgaactctccaacttcgttgatggttcc
gtttcaggatgttacacgagcaatctaaattatcccccattcactcctagaatcctggat
gggtacctgttctccaagagtctctgcatggacgcagtgcagcactggggcaagcagtat
gacgtccacaatctatatggctactccatggcaattgccacggcagaagctgtcaagact
gtgttcccaaataagagaagtttcattataacccgttctacctttgcgggatctggcaag
tttgctgcccactggttaggagacaactcagccacctgggatgatcttcggtggtctatc
cctggcatgctggaattcaacctttttggtatcccaatggtgggtgctgacatatgtggc
tttctgctggacaccactgaggagctctgcaggcggtggatgcagctgggggcattttat
ccattttccaggaatcacaatggccaaggctacaaggcccaggatcctgccttctttggg
gctgactctctgctgttgaactcctccaggcactaccttaccatccgctacaccctatta
ccctacctctacaccctcttctaccgcgcccacagccggggggacacggtggccaggcct
cttctgcatgagttctatgaggacagcaatacgtgggatgtgcaccaacagtttttgtgg
ggccccggcctcctcatcactccggttctagatgagggtgcagagaaagtgatggcatat
atgcctgatgccatctggtacgattacgagactggggcccgagtgagatggaggaagcaa
agagtggagatggaacttcctggagacaaaatcggacttcaccttcgtggaggccacatc
ttccccacgcaacagccagctaccaccacagtggccagtcgtcagaaccctcttggtctt
atcattgccctagatgataacaaagaagcaaaaggcgaacttttctgggatgatggggaa
actaaagatactgtggccaatcaagtttatctcttttgtgagttttctgccacccaaaac
agcttggatgtgaagattttgcagtcaacttacaaagaccccaataatttagtatttaaa
gagattaaaattcttgggatccaggaacctaccaatgttatcgtgaaacacaatggtgtc
caaagtcaagtgtctcctaatgtcacttatgattctaacctacaggttgctcttatagtg
ggaattgatcttatcctgggagaagcatacacagtggagtgggacctgaagataatggat
gcagaaaaaatagactgtttccctgatgagagtggtgcttctgcagaaaactgtaatgcc
cgtggctgtgtctgggaggaatccacttctcctggagtcccgttttgttatttcgtcaat
gatctgtactctgtcggcgatgttcagtacgactcacgtggagccactgcaactatctcc
ttaaagtcttctgtctatgcctccgctctgccctcagtacccgtgacctccctcagtctg
cgtgtgacctaccataagaatgacatgctgcagtttaagatttatgatcccaacaataat
cggtatgaagtcccgatccctctcaacatacccacggttccatccagcacccctgagagt
caactctatgatgtcctcattaagaagaatccatttggaattgaaattcgccgcaagagt
acaggcactgtgatttgggactctcagctccttggcttcaccttcaacgacatgttcatc
cgcatctccactcgccttccttccacgtacctctatggctttggggaaactgaacacaca
gcctttcggagagacttgaactggcacacatgggggatgttctccagagacgagcctcca
gggtacaagaagaattcctatggcgtccacccctactacatggccctggaagaggatggc
agtgcccatggggtgctcctgctaaacagcaatgccatggatgtgacattccaacccctg
cccgccttgacgtaccgcaccataggaggaattctagacttttatgtgttcttggggcca
actccagagcttgtcactcagcagtatactgagatgattggtcgaccagtgatggttcct
tactggtccttggggtttcagctgtgtcgctatggatacgagaacgactctgagattgcc
agcttgtatgatgagatggtggctgcccagatcccttatgatgtgcagtactcggatatc
gactacatggagcggcagctggacttcaccctcagccccaaattcatgggatttccagct
ctgattaatcgcatgaagttggatgggatgcgggtcatcctcattctggacccagccatt
tctggtaacgagacacagccctaccccgcattcactcggggtgtggaagatgatgtcttc
atcaaagctccaaatggtggagacattgtctggggaaaggtgtggcctgattaccctgat
gtcgttataaacgggtctctagactgggatattcaagtggagctataccgagcttatgtg
gcctttcctgactttttccgtaactcaactatcacatggtggaagagggagttgcaagaa
ctatacaccaatccacagaatccagagaggagcctgaagtttgatggcatgtggattgat
atgaatgagccatcgagttttgtgaatggagcagttcccccgggctgcaagaatgcctct
ctgaactaccctccctatatgccatatttggagtccagggacaggggcctgggcagcaag
accctgtgcatggacagtgagcaggtcctgccagatggctcgcgggtgcggcactacgac
gttcacagcctgtatggatgggcccagaccagacccacttacgaagctgtgcaggaggtg
acaggacagagagggattgtcatcacccgctccacgttcccctcttctggccgctgggga
ggtcactggctgggtgacaacacggccgcatgggaccagctgaagaagtctatcattggc
atgatggagttcagcctctttggcatatcttatacaggagcagatatttgtgggttcttt
caagatgctgaatatgagatgtgtgctcgctggatgcaactgggggccttttaccccttt
tcgaggaaccacaacaccattgggaccaggaggcaagaccctgtgtcctgggatgctgcc
ttcgtgaatatgtccagaagtgtgctgcagaccagatacaccctgttgccttatctctac
accctgatgcacatggcccacacggagggcagcaccgtcgtgcggcctcttctccacgag
tttgtgtcagaccgggagacatgggatatagacagtcagtttctgctgggcccagccttc
ctggtcagcgccgtcctggagcctaatgccagaaatgtcactgcgtatttccctagagcc
cgctggtatgattactacacgggtgtggacattggagcaaggggagagtggaagtccttg
gaggcccctcttgaccacattaatcttcatgtccgtgggggctacatcctgccctggcaa
gagcccgcacagaacactcacttaagccgtcagaaattcataggcttcaaagttgccttg
gatgatgaggggactgctaaaggctggctcttctgggatgatggggaaagcattgatacc
tatggagaaggacgctattacctggccaacttttctgccagccagaatatgatgcagagt
catataattttcaacaaatacatcactgattcaaaccctttgaaactgggctacattgag
atctggggagtggacagtgtttccatttccagtgtcagcatctctgtgagcggcatggtg
ataacacccaccttcaattatgaccctgcgacacaggtgttaagcattgatgtgaccagc
agagacatcagcctgcataatttcatttcactgacgtggggaagcactctgtga

DBGET integrated database retrieval system