KEGG   Ailuropoda melanoleuca (giant panda): 100466965
Entry
100466965         CDS       T01329                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase type 7 isoform X1
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00230  Purine metabolism
aml01100  Metabolic pathways
aml01522  Endocrine resistance
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04072  Phospholipase D signaling pathway
aml04114  Oocyte meiosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04371  Apelin signaling pathway
aml04540  Gap junction
aml04611  Platelet activation
aml04713  Circadian entrainment
aml04714  Thermogenesis
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04727  GABAergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04913  Ovarian steroidogenesis
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04921  Oxytocin signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml04972  Pancreatic secretion
aml04976  Bile secretion
aml05032  Morphine addiction
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100466965 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100466965 (ADCY7)
   04371 Apelin signaling pathway
    100466965 (ADCY7)
   04020 Calcium signaling pathway
    100466965 (ADCY7)
   04072 Phospholipase D signaling pathway
    100466965 (ADCY7)
   04024 cAMP signaling pathway
    100466965 (ADCY7)
   04022 cGMP-PKG signaling pathway
    100466965 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100466965 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100466965 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100466965 (ADCY7)
   04062 Chemokine signaling pathway
    100466965 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    100466965 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    100466965 (ADCY7)
   04912 GnRH signaling pathway
    100466965 (ADCY7)
   04913 Ovarian steroidogenesis
    100466965 (ADCY7)
   04915 Estrogen signaling pathway
    100466965 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    100466965 (ADCY7)
   04921 Oxytocin signaling pathway
    100466965 (ADCY7)
   04926 Relaxin signaling pathway
    100466965 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    100466965 (ADCY7)
   04918 Thyroid hormone synthesis
    100466965 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    100466965 (ADCY7)
   04916 Melanogenesis
    100466965 (ADCY7)
   04925 Aldosterone synthesis and secretion
    100466965 (ADCY7)
   04927 Cortisol synthesis and secretion
    100466965 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100466965 (ADCY7)
   04270 Vascular smooth muscle contraction
    100466965 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    100466965 (ADCY7)
   04971 Gastric acid secretion
    100466965 (ADCY7)
   04972 Pancreatic secretion
    100466965 (ADCY7)
   04976 Bile secretion
    100466965 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    100466965 (ADCY7)
   04727 GABAergic synapse
    100466965 (ADCY7)
   04725 Cholinergic synapse
    100466965 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    100466965 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100466965 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    100466965 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    100466965 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100466965 (ADCY7)
   04714 Thermogenesis
    100466965 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100466965 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    100466965 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100466965 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100466965 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100466965 (ADCY7)
   05163 Human cytomegalovirus infection
    100466965 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100466965 (ADCY7)
Enzymes [BR:aml01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100466965 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 100466965
NCBI-ProteinID: XP_019649665
Ensembl: ENSAMEG00000006564
LinkDB
Position
12
AA seq 1081 aa
MPAKGRYFLNEGEEGPDQTALYEKYRLTSQHGPLLLTLLLVAIAACVALIVITFVCGDPS
RHQAVLGTAFFTLAVFVALYVLVYVECLVRRWLRAMALLVWVCLMMLGYMLVFDSWMKAT
HMGAQVPFFLFIVFVAYTLLPFSMQGAVVAGVVSSLSHLLVLGVLMKAFTMPSVQVGLQL
LANAVIFLCGNLTGAFHKHQMQDASRDLFIYTVKCIQIRRKLRIEKRQQESLLLSVLPAH
ISMGMKLAIIERLKERGDRRYVPDNNFHSLYVKRHQNVSILYADIVGFTRLASDCSPKEL
VVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCEAIKQ
VREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LNHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPKPKGDAALKMRA
SVRMTRYLESWGAARPFAHLNHRESVSSGETPVPSGRRPKTIPLRRHRTPDRNTSPKGRS
EDDSYDEEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKDFEREYRLAPIPRARHYFACA
GLVFVCILLVQVLLVPRMAALGVSFGLVACVLGLVLGLCFAREFSRCWPARGTLQAMSER
VETQPLLRLFLAVLTIGSLLSIAIVNLPLMPLWALGLPAGNQTIPSPRAVSSRELTLCEL
FPYYTCSCILAFVACSVFLRMSLELKVVLLTVALVAYLVLFNISPCWQSGCCGHTVANLT
ETNGTLSSSFCVWKDPKAMINFYLVLFYVTLLMLSRQIDYYCRLDCLWKTKFKKEHEEFE
TMENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVLFASVPDFKVFYTECDVNK
EGLECLRLLNEIIADFDELLLKPKFSSVEKIKTIGSTYMAAAGLSSPSGTENQDLERQHA
HIGIMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVA
SRMESTGELGKIQVTEETCTVLQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGL
N
NT seq 3246 nt   +upstreamnt  +downstreamnt
atgccggccaaggggcgctatttcctcaacgagggcgaagagggccctgaccagacggca
ctctacgagaagtaccgcctcaccagccagcacgggccactgctgctcacgctcctgctg
gtggccattgccgcttgcgtcgccctcatcgtcatcaccttcgtctgtggggacccctcc
agacaccaggctgtcctggggacggctttcttcacgcttgccgtgtttgtggctctctac
gtgctggtgtatgttgaatgcctcgtccggcggtggctcagggccatggcgctgcttgtc
tgggtctgcctcatgatgctgggctacatgctggtgttcgactcctggatgaaggccacc
catatgggggcgcaggtgcccttcttcctgttcatcgtcttcgtggcatacacgctgctg
cccttcagcatgcagggggctgtcgtggccggggtggtctccagcctctcccacctcctg
gtgctgggagttctgatgaaggccttcacgatgcccagtgtccaggtgggactgcagctg
ctggccaacgctgtcatcttcctgtgcgggaacctcacgggcgccttccacaagcaccag
atgcaggacgcctctcgagacctcttcatctacaccgtaaagtgcatccagatccgtcgt
aagctgcgcatcgagaagcgtcagcaggagagcttgctgctgtcagtgctgccggcccac
atctccatgggcatgaagctcgccatcatcgagcggctcaaggagcgcggggaccgccgc
tacgtgcccgacaacaacttccacagcctctacgtcaagcggcaccagaacgtcagcatc
ctctatgccgacatcgtgggcttcacgcggctggccagcgactgctccccgaaagagctg
gtggtggtgctgaatgagctcttcggcaagtttgaccagattgccaaggccaatgagtgt
atgcggatcaagatcctgggggactgctactactgcgtgtcgggtctgcccgtatccctg
cccacccatgcccggaactgcgtgaagatgggcctggacatgtgtgaggccattaagcag
gtgcgagaggccacgggtgtggacatcagcatgcgtgtgggcatacactcagggaacgtg
ctgtgtggggtcattgggctgcgcaagtggcagtacgacgtgtggtcccacgatgtgtcc
ctggccaacaggatggaggcggctggagtccctggccgggtgcacatcacggaggcgacg
ctgaaccacctggacaaggcgtatgaggtggaggatgggcacgggcagcagcgggacccc
tacctgaaagaaatgaacattcgtacctacctggtcatcgacccccggagccagcaaccg
cccccgcccagccagcacctccccaagcccaagggggatgcggccctgaagatgcgggcg
tctgtgcgcatgacccgctaccttgagtcctggggggccgcgcggccctttgcgcacctc
aaccatcgtgagagcgtgagcagcggcgagacccctgtgcccagcgggcggaggcccaag
accattcccctgcggcgccaccgcacccctgacaggaacacgtcccccaaggggcggtcg
gaggacgactcatacgatgaggagatgctgtcagccatcgaggggctgagctccacgagg
ccctgctgctccaagtctgatgacttttacacctttgggtctatcttcctggagaaggac
ttcgagcgagagtaccgcctggcgcccatcccgcgggcccgccactacttcgcctgcgcc
ggcctcgtcttcgtctgcatcctgctggtccaggtcctgcttgtgcccaggatggcggct
ctgggtgtgtccttcgggctggtggcctgtgtgctggggctggtgctgggcctgtgcttt
gcccgtgagttctcgaggtgctggccggcccggggaacgttgcaggccatgtctgagagg
gtggagacccagcccctgctgcgcttgttcctggccgtcctgactattggcagcctgctc
agcatcgccatcgtcaacctgccgctgatgcctctctgggccctggggctgcctgcgggc
aaccagacgatcccgagcccgagggctgtgagcagcagggagctgacgctgtgcgagctc
ttcccgtattacacctgtagctgcatcctggcctttgttgcttgctcggtcttcctgcgg
atgagcctggagctgaaggtcgtgctgttgaccgtggccttggtggcttacctggtgctc
ttcaatatctccccgtgctggcagtcgggctgctgtggccacactgtggccaacctcacc
gagaccaacggcaccctcagctcctcattctgcgtgtggaaggacccgaaggccatgatc
aatttctacctggttctgttttacgtcaccctgctcatgctctccagacagattgactac
tactgccgcctggactgtttgtggaagacgaagttcaagaaggaacacgaggagtttgaa
accatggagaatgtgaaccgccttcttctggagaatgtcttgccagcccacgtggccgct
cacttcattggcgacaagttaaatgaggactggtaccatcagtcctacgactgcgtgtgt
gtcctgttcgcgtccgtgccggacttcaaagtcttctatacggagtgcgacgtcaacaag
gaggggctggagtgtctgcggctactgaacgagatcatcgccgacttcgacgagctgctc
ctgaagcccaagttcagcagcgtggagaagatcaagaccatcggcagcacgtacatggca
gctgcagggctcagcagcccctcagggactgagaaccaggacctggagcggcagcacgca
cacattggcatcatggtggagttcagcatcgccctgatgagcaagctggacggcatcaac
cggcactcgttcaactccttccgcctccgagttggcataaaccacgggcccgtgattgct
ggagtgattggggcacgaaaacctcagtacgacatctggggaaacacggttaacgtcgcc
agcaggatggagagcactggagaacttggcaagatccaggttactgaggagacatgcacc
gtcctccagggactaggttattcttgcgaatgccggggactgatcaacgtcaaaggcaaa
ggcgagctgaggacttactttgtctgtacagacactgccaagttccaggggctgggactg
aactga

KEGG   Ailuropoda melanoleuca (giant panda): 100471164
Entry
100471164         CDS       T01329                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X2
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00230  Purine metabolism
aml01100  Metabolic pathways
aml01522  Endocrine resistance
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04072  Phospholipase D signaling pathway
aml04114  Oocyte meiosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04371  Apelin signaling pathway
aml04540  Gap junction
aml04611  Platelet activation
aml04713  Circadian entrainment
aml04714  Thermogenesis
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04727  GABAergic synapse
aml04740  Olfactory transduction
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04913  Ovarian steroidogenesis
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04921  Oxytocin signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04962  Vasopressin-regulated water reabsorption
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml04972  Pancreatic secretion
aml04976  Bile secretion
aml05032  Morphine addiction
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100471164 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100471164 (ADCY3)
   04371 Apelin signaling pathway
    100471164 (ADCY3)
   04020 Calcium signaling pathway
    100471164 (ADCY3)
   04072 Phospholipase D signaling pathway
    100471164 (ADCY3)
   04024 cAMP signaling pathway
    100471164 (ADCY3)
   04022 cGMP-PKG signaling pathway
    100471164 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100471164 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100471164 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100471164 (ADCY3)
   04062 Chemokine signaling pathway
    100471164 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    100471164 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    100471164 (ADCY3)
   04912 GnRH signaling pathway
    100471164 (ADCY3)
   04913 Ovarian steroidogenesis
    100471164 (ADCY3)
   04915 Estrogen signaling pathway
    100471164 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    100471164 (ADCY3)
   04921 Oxytocin signaling pathway
    100471164 (ADCY3)
   04926 Relaxin signaling pathway
    100471164 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    100471164 (ADCY3)
   04918 Thyroid hormone synthesis
    100471164 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    100471164 (ADCY3)
   04916 Melanogenesis
    100471164 (ADCY3)
   04925 Aldosterone synthesis and secretion
    100471164 (ADCY3)
   04927 Cortisol synthesis and secretion
    100471164 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100471164 (ADCY3)
   04270 Vascular smooth muscle contraction
    100471164 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    100471164 (ADCY3)
   04971 Gastric acid secretion
    100471164 (ADCY3)
   04972 Pancreatic secretion
    100471164 (ADCY3)
   04976 Bile secretion
    100471164 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100471164 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100471164 (ADCY3)
   04727 GABAergic synapse
    100471164 (ADCY3)
   04725 Cholinergic synapse
    100471164 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    100471164 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    100471164 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    100471164 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    100471164 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    100471164 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100471164 (ADCY3)
   04714 Thermogenesis
    100471164 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100471164 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    100471164 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100471164 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100471164 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100471164 (ADCY3)
   05163 Human cytomegalovirus infection
    100471164 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100471164 (ADCY3)
Enzymes [BR:aml01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100471164 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 100471164
NCBI-ProteinID: XP_002913837
Ensembl: ENSAMEG00000002572
UniProt: D2GXP9
LinkDB
Position
4
AA seq 1145 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLLVAGMGLLLDIL
LFVLCKKGLLPDRVTRKVVPYLLWLLITAQIFSYLGLNFARAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDGLKGMHLLREILANVFLYLCAIVVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTLDCLKGEFDVEPGDGGSRCE
YLEEKGIETYLIIASKPEVKKTATQHGLGGPALLNGAPASSKPSSPALIETKEPNGSIHT
GGSTSEEPEEQEAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPDMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YMTFVVGEVLLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPTNSTAGLEMEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVTGAVVVINIYAWRPIFDEYDRKRFQEHDFPAVALEKTQGFSTPGLNGTGRLPPVPSK
YSMTAMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEEKSDKERWQHLADLADF
ALAMKDTLTNINHQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQAILREYGFRFVRRGTIFVKGKGELLTFFLKGRDKPAAFPNGSSVTLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgcctaggaaccagggcttctctgagcctgagtactcggccgagtactccgccgagtac
tcggtcagcctgccctctgaccctgaccgcggggtgggccggacccatgaaatctcggtc
cggaactcgggatcctgcctctgcctgcctcggttcatgcggctgaccttcgtgcccgag
tccttggagaacctgtaccagacctacttcaaacggcagcgccacgagaccctgctggtg
ctggtggtgttcgcggcgctcttcgactgctatgtggtggtcatgtgtgcggtggtcttc
tccagcgacaagctggctcccctcctcgtggcggggatgggactgctgttggacatcctc
ctcttcgtactctgcaaaaaggggctgctcccggaccgggtcacgcggaaagtggtgccc
tacctgctgtggctgctgataactgcccagattttctcttacctgggcctgaactttgcc
cgagcccatgcggccagtgacacggtgggctggcaggccttctttgtcttctccttcttc
atcacgctgccgctcagcctcagccccatcgtcatcatctctgtggtctcctgcgtcgtg
cacacactcgtcttgggggtcaccgtggcccagcagcagcaggacgggctgaagggcatg
cacttgctgagggagatcctggcaaacgtcttcctctacctgtgcgccatcgtcgtgggc
atcatgtcctactacatggcggaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaatctggaggagcagagccagcagcaggagaaccttatgctc
tccatcctgcccaagcacgtggctgacgagatgctgaaggacatgaagaaggacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccggcacgagaacgtcagcatc
ctctttgcggacatcgtgggcttcacccagctgtcttctgcctgcagtgcccaggagctc
gtgaagctgctcaacgagctctttgcccgcttcgacaagctggcagctaaataccaccag
ctgcggattaagatcctaggcgactgttactactgcatctgcggcctgcccgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtac
gtgcgggagaagacgaagactggggtggacatgcgcgtgggggtgcacacgggcaccgtg
ctggggggcgtcctgggccagaaacgctggcagtacgacgtgtggtctaccgacgtcact
gtggccaacaagatggaggccggaggcatccccgggcgtgtgcacatctcccagagcacc
ctggactgcctgaagggcgagttcgatgtggagccgggcgacgggggcagccgctgtgag
tacctggaggagaagggcatcgagacctacctcattatcgcgtccaagccagaggtgaag
aaaacagccacccagcacggcctcggtggcccggccctgctgaacggagccccggcttcc
tccaagcccagctcgcccgccctcatcgagaccaaggagcccaacgggagcatccacacc
ggcggctccacgtcggaggagcccgaggagcaggaggcccaggccgacaacccctcgttc
cccaacccgcgccggaggctgcgccttcaggacctggctgaccgagtggtggacgcctcc
gaggacgagcacgagctcaaccagctactcaacgaggccctgctggagcgagagtccgcc
caggtggtgaagaagagaaacaccttcctcctttccatgcggttcatggaccccgacatg
gaaacccgctactcagtggagaaggaaaagcagagcggggctgccttcagctgctcctgt
gtcgtcctgctctgtacggccctggtcgagatactcatcgacccctggctaatgacaaac
tacatgacctttgtggttggggaggttctgcttctgatcctgacaatctgctcgctggcc
gccatctttccccgggcctttcctaagaagctcgtggccttctccacttggattgaccgg
acccgctgggccaggaacacctgggccatgttagccatcttcattctggttatggcaaat
gtcgtggacatgctcagctgtctccagtactacacaggcccgaccaacagcaccgcaggg
ctggagatggaggacggctgcgttgagaaccccaagtattacaactatgtggccgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacactcatg
ctgctcgtcacgggggccgtggtcgtcatcaacatctatgcctggcgccccatctttgat
gaatatgaccgcaaacgttttcaggaacatgacttccctgcagtcgccttagagaagacg
cagggattttccacccctgggctcaatggcactggcaggctgcccccggtgccttctaag
tactccatgaccgcgatgatcttcgtcatgatgctgagcttctactacttctcgcgccac
gtggaaaaattggcaaggacactgttcttgtggaagattgaggtccacgaccagaaggaa
cgggtctacgagatgcggcgctggaatgaggcattggtcaccaacatgttgcctgagcac
gtggcacgccatttcttggggtccaagaagagagatgaggagctgtacagccagtcttac
gatgagatcggagtcatgtttgcctccctgcccaactttgccgacttctacacggaggag
agcatcaacaatggtggcattgagtgtctgcgcttcctcaacgagatcatctcagatttt
gattctctcctggacaatcccaagttccgggtcatcaccaagatcaaaaccattggcagc
acctacatggccgcttccggagtcaccccggatgtcaacaccaacggctttgccagctcc
aacaaggaggagaagtcagacaaggagcgctggcagcacctggctgacctggccgacttc
gctctggccatgaaggatacgctcacgaacatcaaccaccagtccttcaacaacttcatg
ctgcgcatcggcatgaacaaaggaggggtcctcgctggggtcattggagcccggaaacca
cactatgacatctggggcaacacagtcaatgtggccagcaggatggagtccacaggggtc
atgggcaacattcaggtggtggaagaaacacaagccatccttcgagagtacggcttccgc
tttgtgaggcgagggacaatctttgtgaaagggaaaggggagctgctaacctttttctta
aaggggcgtgataagccagctgccttcccgaatggctcctcggtcaccctgccccaccag
gtggtggacaactcctga

KEGG   Ailuropoda melanoleuca (giant panda): 100471940
Entry
100471940         CDS       T01329                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00230  Purine metabolism
aml01100  Metabolic pathways
aml01522  Endocrine resistance
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04072  Phospholipase D signaling pathway
aml04114  Oocyte meiosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04371  Apelin signaling pathway
aml04540  Gap junction
aml04611  Platelet activation
aml04713  Circadian entrainment
aml04714  Thermogenesis
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04727  GABAergic synapse
aml04742  Taste transduction
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04913  Ovarian steroidogenesis
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04921  Oxytocin signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml04972  Pancreatic secretion
aml04976  Bile secretion
aml05032  Morphine addiction
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100471940 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100471940 (ADCY4)
   04371 Apelin signaling pathway
    100471940 (ADCY4)
   04020 Calcium signaling pathway
    100471940 (ADCY4)
   04072 Phospholipase D signaling pathway
    100471940 (ADCY4)
   04024 cAMP signaling pathway
    100471940 (ADCY4)
   04022 cGMP-PKG signaling pathway
    100471940 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100471940 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100471940 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100471940 (ADCY4)
   04062 Chemokine signaling pathway
    100471940 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    100471940 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    100471940 (ADCY4)
   04912 GnRH signaling pathway
    100471940 (ADCY4)
   04913 Ovarian steroidogenesis
    100471940 (ADCY4)
   04915 Estrogen signaling pathway
    100471940 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    100471940 (ADCY4)
   04921 Oxytocin signaling pathway
    100471940 (ADCY4)
   04926 Relaxin signaling pathway
    100471940 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    100471940 (ADCY4)
   04918 Thyroid hormone synthesis
    100471940 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    100471940 (ADCY4)
   04916 Melanogenesis
    100471940 (ADCY4)
   04925 Aldosterone synthesis and secretion
    100471940 (ADCY4)
   04927 Cortisol synthesis and secretion
    100471940 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100471940 (ADCY4)
   04270 Vascular smooth muscle contraction
    100471940 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    100471940 (ADCY4)
   04971 Gastric acid secretion
    100471940 (ADCY4)
   04972 Pancreatic secretion
    100471940 (ADCY4)
   04976 Bile secretion
    100471940 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100471940 (ADCY4)
   04727 GABAergic synapse
    100471940 (ADCY4)
   04725 Cholinergic synapse
    100471940 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    100471940 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    100471940 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    100471940 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    100471940 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    100471940 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100471940 (ADCY4)
   04714 Thermogenesis
    100471940 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100471940 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    100471940 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100471940 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100471940 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100471940 (ADCY4)
   05163 Human cytomegalovirus infection
    100471940 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100471940 (ADCY4)
Enzymes [BR:aml01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100471940 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 100471940
NCBI-ProteinID: XP_034504588
Ensembl: ENSAMEG00000015964
LinkDB
Position
20
AA seq 1170 aa
MEQSSHNQLGKGWEATGSAWQMGSPRGWGNGVEVAWTQGERHGWGTERPHAVTRHLALPS
PGGPPSTPAPQRGAGGTMARLFSPRPPPSEDLFYETYYSLSQQYPLVLLLLVIVLCALLA
MLAVASASGRDLASDRGFLTTVLCALGGFSLLLGLASREQRLQRWTRPLSVLVWAALLGL
GHGFLFTGGLVSAWDQVSFFLFVIFTVYAMLPLGMRDAAAAGLASSLSHLLALGLYLGPQ
PDSRPALLPQLAANAVLFLCGNVAGAYHKALMERALRATFREALRSLHSRRRLDTEKKHQ
EHLLLSILPAYLAREMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFT
RLASECSPKELVLMLNELFGKFDQIAKVPPPPPAHTHTPRSMNACGSRSWETVTTVSLGY
RSPCQTTPSTACAWGWTCAGPSGQLRKLRAATGVDINMRVGVHSGSVLCGVIGLQKWQYD
VWSHDVTLANHMEAGGVPGRVHITGATLALLAGVYAVEDASMEHRDPYLRELGEPTYLVI
DPRAEEEEEKGTAGGLLSSLEGPQMRPSLLMTRYLESWGAAKPFAHLSHLESPVSTSTPL
PEKALASFSPQWSLDRSRTPRGLDEDLDTGDAKFFQVIEQLNSQKQWKQSKDFNPLTLYF
REKELEKEYRLSALPAFKYYAACTFLVFFSNFIIQMLVTNRPPALAVTYSITFLLFLLLL
FVCFSEHLTKCVLKGPKMLHWLPALSGLVATRPGLRVALGTATILLVFVMAITSLFFLPA
ATNCPSGASNVSSVASNLSWELPGSLPLISVPYSMHCCVLGFLSCSLFLHMSFELKLLLL
LLWLGVSCSLFLHSHAWLSDCLIARLYPDPLDSRPGVLKEPKVMGAISFFIFFFTLLVLA
RQNEYYCRLDFLWKKKLRQEQEETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQ
SYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTI
GSTYMAATGLNATPGQDAQQDAERSCNHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGL
NHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETARVLQSLGYTCYSRG
IIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3513 nt   +upstreamnt  +downstreamnt
atggagcagtcttctcacaaccaactgggaaaaggctgggaggccacagggagtgcctgg
cagatgggatcgccgcgaggctgggggaacggggtggaagtggcttggacccagggagag
aggcacggctggggcacagagcggcctcacgcggtaacgcggcacctggccctccccagc
cccgggggtccaccctccacgccggcgccgcagcgaggggcaggggggaccatggcccgc
ctcttcagtccccggccgccccccagcgaagacctcttctacgagacctactacagcctg
agtcagcagtacccactggtgcttctgctgctggtgatcgtgctctgcgcgctcctggcg
atgctggctgtcgcctccgccagcggcagggatctagcttcagaccggggcttcctgacc
accgtgctgtgcgcgctcgggggcttctcgctgctcctgggcctggcttcccgcgagcaa
cggctgcagcgctggacacgtcccctgtcggtcctcgtgtgggccgcgctactcgggcta
ggccatggcttcctgttcaccgggggcctggtgagcgcctgggaccaggtgtcctttttc
ctcttcgtcatcttcaccgtgtacgccatgttgcccttgggcatgcgggatgccgccgct
gcgggccttgcctcgtcgctctcccacctgctggcccttgggctgtaccttgggcctcag
ccggactccaggccggcgctgctgccgcagctggcagcgaacgccgtgttgttcttgtgc
gggaacgtggccggagcgtaccacaaggcgctgatggagcgcgctctgcgcgccacgttc
cgggaggctcttcgttccctgcactcgcgccggcggctggacaccgagaagaagcaccag
gaacaccttctcttgtccattcttcctgcctacctggcccgagagatgaaggcagagatc
atggcacggctgcaggctggacaggggtcccggccagagagcaccaacaacttccacagc
ctctatgtcaagaggcaccagggagtgagcgtgctgtatgctgacatcgtgggcttcacc
cggctggccagtgagtgctcccctaaggagctggtgctcatgctcaacgagctcttcggc
aagttcgaccagattgccaaggtgcccccccctccccctgcacacacacacactcccagg
agcatgaatgcatgcggatcaagatcctgggagactgttactactgtgtctctgggctac
cgctctccctgccagaccacgccatcaactgcgtgcgcatggggctggacatgtgccggg
ccatcaggtcagctcaggaaactccgggcggccactggcgtggacatcaacatgcgtgtg
ggcgtgcactcgggcagtgtgctctgcggagtcatcgggctgcagaagtggcagtatgat
gtctggtcccatgatgtcacactggccaaccacatggaggcgggcggcgtgccaggacga
gtacatatcacaggggctaccctggccctgctggccggggtctatgctgtggaagatgca
tcgatggaacaccgggacccataccttcgggagctaggggagcccacttacctggtcatc
gacccccgggctgaggaggaggaggagaagggcactgcgggagggctgctgtcctctctc
gagggcccccagatgcgcccatcactgctgatgacccgctacctggagtcctggggcgcg
gccaagccttttgcccacctgagccacctagagagccctgtgtccacttccacccctctc
ccggagaaggccctggcctccttcagcccccaatggagcctggaccggagccgtaccccc
cggggactagatgaggacctggacactggggacgccaagttcttccaggtcatcgaacag
ctcaactctcagaagcagtggaagcagtcaaaggacttcaacccactgacactgtacttc
agagagaaggagctggagaaagagtatcgactttctgccctccccgccttcaaatactat
gcggcctgcaccttcctggtcttcttctccaatttcatcatccagatgctggtgaccaac
aggcccccagctctggccgtcacctatagcatcaccttcctcctcttcctcctccttctc
ttcgtctgcttctcagagcacctgacgaagtgtgtcttgaaaggccccaagatgctgcac
tggctgcccgcactgtctggcttggtggccacacggcccggactccgagttgccctgggc
actgccaccatcctcctcgtttttgtcatggctattaccagcctgttcttcttaccggca
gcaacaaactgcccttccggggcttccaatgtgtcctccgtggcttccaacctctcctgg
gagctccctggctccctgcctctcatcagcgtcccatactctatgcactgctgcgtgctg
gggttcctgtcttgctccctctttctgcacatgagcttcgagctgaagttgctgttgctc
ctgctgtggctgggggtctcctgctccctcttcctgcactcccacgcctggctgtccgac
tgcctcatcgcccgcctctatccagatcccttggactccaggccaggggtgctaaaggag
cccaaagtgatgggagctatctccttcttcatcttcttcttcaccctccttgtcctggct
cggcagaatgagtattactgccgcctggacttcctgtggaagaagaagctgcggcaggag
caggaggagacagagaccatggagaacctgactcggctgctgctggagaatgtgctccct
gcgcacgtggcgccccagttcattggccagaaccggcgcaacgaggacctctaccaccag
tcctacgagtgtgtctgtgtcctcttcgcctcagttccagactttaaggagttttactct
gaatccaacatcaaccacgagggtctagagtgtctgcggttgctcaatgagatcatcgct
gattttgatgagctgctctcaaagcccaagtttagcggggtggagaagatcaaaaccatc
gggagcacctacatggcagccacgggcttaaatgccacccccggacaggatgcacagcag
gatgccgagcgaagctgcaaccacctgggcaccatggtggagttcgcagtggccctcgga
tcgaagctggatgtcatcaacaagcactcattcaacaacttccgcctgcgtgtggggttg
aaccacggacctgtagtggctggagtgattggggcccagaagcctcagtatgacatctgg
ggtaacacggtgaatgtggccagccgcatggaaagtacgggagtcctgggcaagatccaa
gtgactgaagagacagcccgggtgctgcaatccttaggctatacgtgctacagccggggc
atcatcaaggtcaaaggcaaagggcagctctgcacctacttcctgaacacagatttgaca
cgaactggccctccctcggccaccctaggctga

KEGG   Ailuropoda melanoleuca (giant panda): 100472777
Entry
100472777         CDS       T01329                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase type 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00230  Purine metabolism
aml01100  Metabolic pathways
aml01522  Endocrine resistance
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04072  Phospholipase D signaling pathway
aml04114  Oocyte meiosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04371  Apelin signaling pathway
aml04540  Gap junction
aml04611  Platelet activation
aml04713  Circadian entrainment
aml04714  Thermogenesis
aml04720  Long-term potentiation
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04727  GABAergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04913  Ovarian steroidogenesis
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04921  Oxytocin signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml04972  Pancreatic secretion
aml04976  Bile secretion
aml05032  Morphine addiction
aml05142  Chagas disease
aml05146  Amoebiasis
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100472777 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100472777 (ADCY1)
   04371 Apelin signaling pathway
    100472777 (ADCY1)
   04020 Calcium signaling pathway
    100472777 (ADCY1)
   04072 Phospholipase D signaling pathway
    100472777 (ADCY1)
   04024 cAMP signaling pathway
    100472777 (ADCY1)
   04022 cGMP-PKG signaling pathway
    100472777 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100472777 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100472777 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100472777 (ADCY1)
   04062 Chemokine signaling pathway
    100472777 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    100472777 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    100472777 (ADCY1)
   04912 GnRH signaling pathway
    100472777 (ADCY1)
   04913 Ovarian steroidogenesis
    100472777 (ADCY1)
   04915 Estrogen signaling pathway
    100472777 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    100472777 (ADCY1)
   04921 Oxytocin signaling pathway
    100472777 (ADCY1)
   04926 Relaxin signaling pathway
    100472777 (ADCY1)
   04935 Growth hormone synthesis, secretion and action
    100472777 (ADCY1)
   04918 Thyroid hormone synthesis
    100472777 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    100472777 (ADCY1)
   04916 Melanogenesis
    100472777 (ADCY1)
   04925 Aldosterone synthesis and secretion
    100472777 (ADCY1)
   04927 Cortisol synthesis and secretion
    100472777 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100472777 (ADCY1)
   04270 Vascular smooth muscle contraction
    100472777 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    100472777 (ADCY1)
   04971 Gastric acid secretion
    100472777 (ADCY1)
   04972 Pancreatic secretion
    100472777 (ADCY1)
   04976 Bile secretion
    100472777 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100472777 (ADCY1)
   04727 GABAergic synapse
    100472777 (ADCY1)
   04725 Cholinergic synapse
    100472777 (ADCY1)
   04720 Long-term potentiation
    100472777 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    100472777 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100472777 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    100472777 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    100472777 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100472777 (ADCY1)
   04714 Thermogenesis
    100472777 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100472777 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    100472777 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100472777 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100472777 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100472777 (ADCY1)
   05163 Human cytomegalovirus infection
    100472777 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100472777 (ADCY1)
   05142 Chagas disease
    100472777 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100472777 (ADCY1)
Enzymes [BR:aml01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100472777 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 100472777
NCBI-ProteinID: XP_011228163
Ensembl: ENSAMEG00000014806
LinkDB
Position
1
AA seq 907 aa
MYGVFVRVLAERSQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLK
PPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCR
RIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVL
CGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNSF
LKAHNIETFFIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFS
NVMTCEDDDKRRALRTASEKLRNRSSFSANVVYTTPGTRVNRYISRLLEARQMELEMADL
DFFTLKYKQAERERKYHKLQDEYFTSAVVLALVLAALFGLVYLLIIPQSVVLLLLLVFCI
CFLVACVLYLHIARVQCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWSSSPNG
SLVVLTPGGRNAVLPAAPCESAPHALLCGLVGTLPLAIFLRVSSLPKMILLFVLSASYIL
VLELSGYTRASGGGAVSGRSFEPIVAILLFSCTLALHARQVDIKLRLDYLWAAQAEEERD
DMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFDDFYIEL
DGNNMGVECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTTGTKAKKCI
SSHLSTLADFAIEMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVN
VASRMDSTGVQGRIQVTEDVHRLLRRGTYRFVCRGKVSVKGKGEMLTYFLEGRTDANGSQ
ARSLNAERKMCAYGRAGLQTRLAAGPPPVGPMIGHPVRAGLGSLQGSGLPPGPHGQHPPP
GAAGKEA
NT seq 2724 nt   +upstreamnt  +downstreamnt
atgtacggggtgttcgtgagggtcctggccgaacgctcccaaaggaaagccttcttgcag
gcccggaactgcatcgaagaccggctgaggctggaggatgagaacgagaagcaggagcgg
ctgcttatgagccttctgccccggaacgttgccatggagatgaaggaggacttcctgaag
ccccctgagaggattttccacaagatttacatccagcggcatgacaatgtgagcatcctc
ttcgcggacatcgtgggcttcacgggcttggcgtcacagtgcacggcgcaggagctggtg
aagctgctcaacgagctcttcggcaagtttgatgaactggccacggagaaccactgtcgc
cggatcaagatccttggggactgctattactgcgtgtctggcctcacccagcccaagact
gaccacgcccactgctgcgtggagatgggcctggacatgatcgacaccatcacgtcggtg
gcagaggccacggaggtggatctgaacatgcgtgtggggctgcacactggccgggtcctc
tgcggggtcctcggcctgcgcaagtggcagtacgacgtgtggtccaatgacgtgaccctg
gccaatgtcatggaggccgctggcctgcctgggaaggtccacatcacgaagacgaccctg
gcgtgcttgaacggtgactacgaggtggagccggggcacgggcacgagaggaacagcttt
ctgaaagctcacaacatcgagaccttcttcattgtgccgtcacatcggcggaagatcttt
ccagggctgatcctttcggacataaagcccgccaagaggatgaagttcaagaccgtgtgc
tacctgctggtgcaactcatgcactgtcggaagatgttcaaggcggagatccccttctcc
aacgtcatgacgtgcgaggatgacgacaagcggagggcgttgagaaccgcgtcagaaaaa
ctcagaaaccgctcgtccttctctgcgaatgtcgtctacaccaccccgggcacgcgtgtc
aacaggtacatcagccgcctcctagaagcacgccagatggagctggagatggcggacctg
gacttcttcaccctgaagtacaaacaggctgagcgcgagcgcaagtaccacaagctccag
gacgagtatttcaccagtgccgtcgtgctcgcgctcgtcctggccgccttgttcggcctc
gtctaccttctcatcatcccgcagagcgtggtcctcctcctgctgctggtgttctgcatc
tgcttcctggtggcctgtgtcctgtacctgcacattgcccgggtccagtgttttccagga
tgcctgacgatccagatccgcaccgtcttgtgtattttcatagtggtcctcatctactcg
gtggcccaaggatgtgtggtgggctgcctgccctgggcctggagctccagccccaacggg
tccctggtggtcctgacacctggtggccggaatgccgtgctgcccgccgcaccctgcgag
tctgcgccccacgcactgctctgcggccttgtgggcaccctgccgctggccatcttcctg
cgggtgtcctccctgcccaaaatgatcctgctcttcgtgctctcggcatcctacatcctg
gtcctggagctcagcgggtacaccagggcctcagggggcggcgcggtgtccgggcgcagc
ttcgagccgatcgtggccatcctgctgttctcgtgcacgctggccctgcacgcccggcag
gtggacatcaagctgcggctggactatctctgggcagcacaggcagaggaggagagggac
gacatggagagggtgaagctggacaacaagaggattctcttcaacctcctgccagcccac
gttgcccagcacttcctcatgtccaacccccggaacatggacctgtactaccagtcctac
tcgcaggtgggcgtcatgttcgcctccatccccaactttgacgacttctatatcgagctg
gatggcaacaacatgggggtggagtgtctgcgccttctgaatgagatcatcgctgacttt
gatgagctcatggacaaagacttctacaaggacctggagaagatcaagaccatcgggagc
acctatatggctgcggtgggactagcgccaacaactgggaccaaggcaaagaagtgcatc
tcctcgcacctcagcacactggcggacttcgccatcgagatgttcgacgtcctggatgaa
atcaactaccagtcttacaacgactttgtgctccgtgtgggcatcaacgttggccccgtg
gtggccggggtgatcggggctcgaaggccgcagtacgacatctggggaaacacggtcaat
gtggccagtaggatggacagcaccggtgtccagggcagaatccaggtgaccgaggacgtt
caccggctgctgcgaaggggcacttaccgcttcgtgtgccgcgggaaggtcagcgtcaag
ggcaagggtgagatgctgacatacttcctggaaggccggaccgatgcaaacggttcccag
gccaggtccctgaacgcagagcggaaaatgtgcgcttacgggcgagccggcctccagacc
agactggccgcagggccacccccggtgggccccatgatcggccacccggtcagagccggg
ctggggtctctgcagggctcggggctccccccgggcccccacggccagcacccacccccc
ggagcagctgggaaggaggcttag

KEGG   Ailuropoda melanoleuca (giant panda): 100473195
Entry
100473195         CDS       T01329                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase type 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00230  Purine metabolism
aml01100  Metabolic pathways
aml01522  Endocrine resistance
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04072  Phospholipase D signaling pathway
aml04114  Oocyte meiosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04371  Apelin signaling pathway
aml04540  Gap junction
aml04611  Platelet activation
aml04713  Circadian entrainment
aml04714  Thermogenesis
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04727  GABAergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04913  Ovarian steroidogenesis
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml04972  Pancreatic secretion
aml04976  Bile secretion
aml05032  Morphine addiction
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100473195 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100473195 (ADCY2)
   04371 Apelin signaling pathway
    100473195 (ADCY2)
   04020 Calcium signaling pathway
    100473195 (ADCY2)
   04072 Phospholipase D signaling pathway
    100473195 (ADCY2)
   04024 cAMP signaling pathway
    100473195 (ADCY2)
   04022 cGMP-PKG signaling pathway
    100473195 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100473195 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100473195 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100473195 (ADCY2)
   04062 Chemokine signaling pathway
    100473195 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    100473195 (ADCY2)
   04922 Glucagon signaling pathway
    100473195 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    100473195 (ADCY2)
   04912 GnRH signaling pathway
    100473195 (ADCY2)
   04913 Ovarian steroidogenesis
    100473195 (ADCY2)
   04915 Estrogen signaling pathway
    100473195 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    100473195 (ADCY2)
   04921 Oxytocin signaling pathway
    100473195 (ADCY2)
   04926 Relaxin signaling pathway
    100473195 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    100473195 (ADCY2)
   04918 Thyroid hormone synthesis
    100473195 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    100473195 (ADCY2)
   04916 Melanogenesis
    100473195 (ADCY2)
   04925 Aldosterone synthesis and secretion
    100473195 (ADCY2)
   04927 Cortisol synthesis and secretion
    100473195 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100473195 (ADCY2)
   04270 Vascular smooth muscle contraction
    100473195 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    100473195 (ADCY2)
   04971 Gastric acid secretion
    100473195 (ADCY2)
   04972 Pancreatic secretion
    100473195 (ADCY2)
   04976 Bile secretion
    100473195 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100473195 (ADCY2)
   04727 GABAergic synapse
    100473195 (ADCY2)
   04725 Cholinergic synapse
    100473195 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    100473195 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100473195 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    100473195 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    100473195 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100473195 (ADCY2)
   04714 Thermogenesis
    100473195 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100473195 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    100473195 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100473195 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100473195 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100473195 (ADCY2)
   05163 Human cytomegalovirus infection
    100473195 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100473195 (ADCY2)
Enzymes [BR:aml01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100473195 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 100473195
NCBI-ProteinID: XP_034512990
LinkDB
Position
3
AA seq 997 aa
MSQQHPLIVFLLLIVMGACLALLAVFFALRLDVEDHVAFLITVPTALAIFFAIFILVCIE
SVFRKLLRLFSVLIWICLVAMGYLFMCFGGTVSPWDQILANVIIFICGNLAGAYHKHLME
LALQQTYQDTCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIRRLQGPRAGQME
NTNNFHNLYVKRHTNVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMR
IKILGDCYYCVSGLPISLPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLC
GVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYL
KQHLVKTYFVINPKGERRSPHLFRPRHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRD
SMTTENGKISTTDVPMGQHNFQNRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSE
DIQRISLLFYNKILEKEYRATALPAFKYYVTCACLIFFCIFIVQILVLPKTSILGISFGA
AFLLLAFILFICFAGQLLQCSKKASASLLWLLKSSGIIADRPWPRVSLTVLTTAIILTMA
VFNMFFLSDPEETIPPTANTSNTSLSALSNQAAILRAQNLFFLPYCIYSCVLGLISCSVF
LRVNYELKMLIMMVALVGYNTILLHTHAHVLDDYSQVLFERPGIWKDLKTMGSVSLFIFF
VTLLVLGRQNEYYCRLDFLWKNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLK
NEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSG
VEKIKTIGSTYMAATGLSAVPSQEHAQEPERQYMHIGTMVEFAFALVAKLDAINKHSFND
FKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLG
YTCTCRGIINVKGKGELKTYFVNTEMSRSLSQSNLAS
NT seq 2994 nt   +upstreamnt  +downstreamnt
atgagccagcagcacccgctcatcgtcttcctgctgctcatcgtcatgggcgcctgcctc
gccctgcttgccgtcttcttcgcgctccggctggacgttgaagaccatgtggcattttta
atcacggtcccgacagccctggcgatcttctttgcgatattcatcctcgtctgcatcgag
tccgtgttcaggaagctgctacgcctcttctctgtgctgatatggatctgcctcgtggcc
atgggctacctgttcatgtgcttcggaggcaccgtctctccctgggaccagatcctggcc
aatgtgatcattttcatctgtgggaacctggcaggagcataccacaagcacctcatggag
ctggccttgcagcagacatatcaggacacctgcaactgtatcaagtctcggatcaagctg
gaatttgaaaagcgtcagcaggagcggcttctgctctccctgctgccggctcacatagcc
atggaaatgaaagccgagatcatccggaggctgcagggccccagagccggccaaatggaa
aacacaaacaacttccacaacctgtatgtcaagcgacataccaacgtgagcatcctgtat
gctgatattgttggcttcacccggctggccagtgactgctccccaggagaactggtccac
atgctgaacgagctctttggaaagttcgaccaaattgcaaaggagaatgaatgcatgaga
ataaaaattttgggagactgctactactgtgtgtccggacttcctatatctctcccgaac
catgccaagaactgtgtgaaaatggggctggacatgtgtgaagccataaagaaagtgagg
gacgccactggagtggatatcaacatgcgcgtgggagtgcattctgggaacgtcctctgc
ggggtgattggtctgcagaagtggcagtatgacgtgtggtcacatgacgttaccttggcc
aatcacatggaagctggaggggtccctggacgtgttcacatttcttccgtcaccctggaa
cacttgaacggcgcttataaagtggaggaaggagacggtgacatcagagacccatattta
aaacagcacctggtgaaaacctactttgtcatcaaccccaagggagaacgaaggagtcct
cacctcttcagacctcgccataccctcgatggagccaagatgagggcctctgtgcgcatg
acccggtacctggagtcctggggggcggccaagccctttgcacacctgcatcaccgagac
agcatgaccacggagaatggcaaaatcagcaccacggatgtgccaatgggtcagcataat
tttcaaaatcgtaccttaagaaccaagtcccaaaagaagagatttgaagaagaattaaat
gaaaggatgattcaagcaattgatggaattaacgcacaaaagcagtggctcaagtctgaa
gacattcagagaatctcactcctgttctacaataaaatactagaaaaagaataccgagcc
accgccctgccagcgtttaagtactacgtgacctgcgcatgtctcatattcttctgcatt
ttcattgtgcagattctggtgttaccaaaaacgtccattctggggatttcctttggagct
gcatttctcttgctcgcctttatcctcttcatctgctttgctggacagcttttgcaatgc
agcaagaaggcctccgcctctctcctgtggctgttgaagtcgtcgggcatcatcgcggac
cggccctggcctcgtgtctccctcactgtcctcaccacggccatcattctgaccatggcc
gtgttcaacatgtttttcctgagtgacccagaggaaacaattcctccaactgccaatacg
tccaacacaagtctttctgccttaagtaatcaggcagcgattctacgggcacaaaatctg
tttttcctcccgtactgcatctacagctgcgtcctggggctgatctcctgctcggttttc
ctgagggtgaattacgagttgaagatgttgatcatgatggtggcgttggtgggctacaac
accatccttctacacacgcacgcccacgtcctggacgactacagccaggtcttattcgag
agaccaggcatttggaaagacctgaagaccatgggctcagtgtctctctttatattcttc
gtcacactgcttgttctgggtagacagaatgaatattactgtaggttagacttcttatgg
aagaacaagttcaaaaaagagcgggaggagatagaaaccatggaaaacctgaaccgcgtg
ctgctggagaacgtgctgcccgcgcacgtggcggagcatttcctggcccggagcctgaag
aacgaggagttataccaccagtcctatgactgtgtctgcgtcatgtttgcctctattccg
gatttcaaagaattctacacagaatcagatgtgaacaaggagggcttggagtgccttcgg
ctcctgaatgagatcatcgccgactttgatgatctgctgtccaagccgaagttcagtgga
gttgaaaagatcaagaccatcggcagcacatacatggcggcgaccggtctgagcgccgtg
cccagccaggagcacgcccaggagccggagaggcagtacatgcacattggcaccatggtg
gagtttgcctttgcactggtggcgaagctggacgccatcaacaagcactccttcaacgac
ttcaagctgcgagtgggtattaaccacggacctgtgatagccggtgtgattggagctcag
aaaccgcagtatgatatctggggcaacactgtaaacgtggccagcaggatggacagcacc
ggcgtgctggacaagatacaggtcaccgaggagaccagcctcatcctccagaccctgggg
tacacgtgcacgtgtcgaggaataatcaatgtgaaaggcaagggggagctgaagacgtac
tttgtgaacacagaaatgtcaaggtccctttcccagagcaacttggcatcctga

KEGG   Ailuropoda melanoleuca (giant panda): 100474121
Entry
100474121         CDS       T01329                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase type 8
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00230  Purine metabolism
aml01100  Metabolic pathways
aml01522  Endocrine resistance
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04072  Phospholipase D signaling pathway
aml04114  Oocyte meiosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04371  Apelin signaling pathway
aml04540  Gap junction
aml04611  Platelet activation
aml04713  Circadian entrainment
aml04714  Thermogenesis
aml04720  Long-term potentiation
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04727  GABAergic synapse
aml04742  Taste transduction
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04913  Ovarian steroidogenesis
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04921  Oxytocin signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml04972  Pancreatic secretion
aml04976  Bile secretion
aml05032  Morphine addiction
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100474121 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100474121 (ADCY8)
   04371 Apelin signaling pathway
    100474121 (ADCY8)
   04020 Calcium signaling pathway
    100474121 (ADCY8)
   04072 Phospholipase D signaling pathway
    100474121 (ADCY8)
   04024 cAMP signaling pathway
    100474121 (ADCY8)
   04022 cGMP-PKG signaling pathway
    100474121 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100474121 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100474121 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100474121 (ADCY8)
   04062 Chemokine signaling pathway
    100474121 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    100474121 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    100474121 (ADCY8)
   04912 GnRH signaling pathway
    100474121 (ADCY8)
   04913 Ovarian steroidogenesis
    100474121 (ADCY8)
   04915 Estrogen signaling pathway
    100474121 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    100474121 (ADCY8)
   04921 Oxytocin signaling pathway
    100474121 (ADCY8)
   04926 Relaxin signaling pathway
    100474121 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    100474121 (ADCY8)
   04918 Thyroid hormone synthesis
    100474121 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    100474121 (ADCY8)
   04916 Melanogenesis
    100474121 (ADCY8)
   04925 Aldosterone synthesis and secretion
    100474121 (ADCY8)
   04927 Cortisol synthesis and secretion
    100474121 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100474121 (ADCY8)
   04270 Vascular smooth muscle contraction
    100474121 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    100474121 (ADCY8)
   04971 Gastric acid secretion
    100474121 (ADCY8)
   04972 Pancreatic secretion
    100474121 (ADCY8)
   04976 Bile secretion
    100474121 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    100474121 (ADCY8)
   04727 GABAergic synapse
    100474121 (ADCY8)
   04725 Cholinergic synapse
    100474121 (ADCY8)
   04720 Long-term potentiation
    100474121 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    100474121 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    100474121 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    100474121 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    100474121 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    100474121 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100474121 (ADCY8)
   04714 Thermogenesis
    100474121 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100474121 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    100474121 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100474121 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100474121 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100474121 (ADCY8)
   05163 Human cytomegalovirus infection
    100474121 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100474121 (ADCY8)
Enzymes [BR:aml01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100474121 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 100474121
NCBI-ProteinID: XP_002917664
Ensembl: ENSAMEG00000013039
UniProt: D2H7A3
LinkDB
Position
9
AA seq 1252 aa
MELSDVRYLTGPEELYTIHPTPPAGDGGSGSRPQRLLWQTAVRHITEQRFIHGHRGSGGG
SGRRGSGKASNPAGGGPNHHAAPLSGDSALPLYSLGPGERAHSTGGTKVFPERSGSGSCS
GSGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRR
KSEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSH
TYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGT
SLLQVVLQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEA
RLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFAD
VKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHA
HCCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANK
LESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLSLPE
DIVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALH
VQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCA
FIVLLFITAIQSLLPSSRLMPMAIQFSILIMLHSALVLITTAEDYKCLPLVLRKTCCWIN
ETYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLAFNSSAVFTDICSYPEYFVFT
GVLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETVYAGLFLRYDNLNHSGEDFLGTKE
ASLLLMAVFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHV
ARHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFD
ELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINK
HSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLI
LKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGL
VQSLNRQRQKQLLNENNATGIIKGHYNRRTLLAPSGPEPGAPAEGTDKSDLP
NT seq 3759 nt   +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctacctgaccggccctgaggaactctacaccatccacccg
acgcccccggccggcgacggcgggagcggctcccggccgcagcggctgctgtggcagacg
gcggtgaggcacatcaccgagcagcgcttcattcacggacaccggggcagcggcggcggc
agcgggaggagaggctccggcaaagcctcgaaccctgcaggcggcggccccaaccatcac
gcggcgccgctgtccggcgactcggcgctgcccctctactcgctgggccccggggagaga
gcgcacagcaccggtggcaccaaagtcttcccggaacgcagcgggagcggcagctgcagc
ggcagcgggggcgggggcgatctgggcttcctgcacctcgactgcgccccgagcaactcg
gatttcttcctcaatgggggctacagctacagaggggtcatttttcccactctgcgcaac
tccttcaagtcccgggatctggagcgcctctaccagcgctatttcctgggccagaggcgc
aaatccgaggtggtgatgaacgtgctggacgtgctgaccaaactcaccctcttggtcctg
cacttgagcctggcctcggcccccatggatccgctcaagggcatcctcctgggcttcttc
actggcatcgaggtggtgatctgcgccctggtggtggtcaggaaggacaccacctcgcac
acgtacctgcagtacagcggcgtggtcacttgggtggccatgaccacccagatcttggcg
gcaggcctcggctacgggcttctgggtgatggcatcggctacgttctcttcacgctgttc
gccacctacagcatgctgccgctgccgctcacctgggccatcctagccggcctgggcacc
tcgctgctgcaggtggtcctgcaggtggtcatcccccggctagcggtcatttccatcaac
caggttgtggcccaggcagtgttgttcatgtgtatgaacacagctgggatcttcatcagt
tacctgtcagaccgggcccagcgccaagccttcctggagacgcggaggtgtgtggaggcc
aggctccgcctggagacggaaaaccaaagacaggagcgtctcgtgctatctgtgctcccc
cgctttgtcgtcctggaaatgatcaatgacatgaccaatgttgaagacgagcacttgcag
caccagttccatcggatctacatccatcgctatgagaacgtcagtattctttttgcagat
gttaaaggatttaccaacctctcaacaaccttgtctgcccaggagctggtccggatgctc
aacgagctctttgccagatttgatcgactggcccatgagcatcactgccttcgcattaaa
atcctgggggactgttactactgtgtttcagggcttcctgagccccgccaggaccacgcc
cactgctgcgttgaaatgggcctcagcatgatcaaaaccatcaggtatgtgaggtcgagg
acgaagcatgatgtggacatgcggattggaatccactccggctcggtgctgtgtggcgtg
ttgggcctgcggaagtggcagtttgatgtctggtcttgggatgtggacattgcaaacaaa
ctcgaatctggaggaatccccgggaggattcacatttccaaagccacgctggactgcctc
aacggtgactataacgtggaagagggtcatggtaaagagagaaacgaattcttgaggaag
cataatattgagacctatttgattaagcagcctgaagagagtctgctgtcattgcccgaa
gacatcgtcaaggagtcggtgagctcctcagacaggagaaacagtggggcgacattcaca
gaaggatcctggagccccgaactgccctttgataacatagtggggaaacagaacactctg
gctgccctaacaagaaattcaataaatctacttccaaaccatcttgcacaagctttgcat
gtccagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagt
ggcgataaattgagaagagagcatatcaagccattctcactgatgtttaaagactccagc
ctggagcacaagtattctcaaatgagggatgaagtattcaagtcaaacttggtctgtgca
tttatcgttcttctctttatcacggcgatacaaagtttgcttccttcctcaaggctgatg
ccgatggccatccagttttccatcctgattatgctgcactcggctctggtcctcatcacc
acggcggaggattataagtgtttgccccttgtcctccggaaaacttgctgttggattaac
gagacctatttggcccggaacgtcattatctttgcatccatcttgattaacttcctgggc
gccatcttgaatatcctgtggtgtgattttgacaagtcgatacccttgaagaacctggct
ttcaattcctcagctgtgtttacagatatctgctcctacccagagtacttcgtgttcact
ggggtgctggccatggtgacctgtgcggttttcctccgcctgaactctgtcctgaagctg
gccgtgctgctgattatgatcgccatctatgccctgctcaccgagaccgtctacgcgggc
ctctttctgcgctacgacaacctgaaccacagtggagaagatttcctggggaccaaggag
gcgtcactgctcctgatggccgtgttcctccttgccgtgttctaccacggacagcagctg
gagtatacagcccgccttgacttcctctggcgggtacaggccaaagaggagatcaatgag
atgaaggagctgagggaacacaacgagaacatgctccggaacattctacccagccacgtg
gcccgccacttcctggagaaagaccgagacaacgaggagctgtattctcaatcctacgat
gccgtcggggtgatgttcgcctctatcccagggttcgcagacttctactctcagactgaa
atgaataaccaaggagtggaatgcctgcgcctgctgaatgagatcattgctgacttcgat
gagctgctcggcgaagaccggtttcaagacattgaaaagattaagaccattggcagcacc
tacatggccgtgtcaggcctgtcacccgaaaaacagcaatgcgaagacaagtggggacat
ttgtgcgccctggccgacttctccctcgccctgaccgagagcatacaggagatcaacaag
cattccttcaacaatttcgaactccggatcggcatcagccacggctcggtggtagccggc
gttatcggcgctaagaaaccgcaatatgacatttggggcaaaaccgtgaacctggcaagt
cgaatggacagcacgggggtcagcggcaggatccaagtccccgaggagacctatctcatc
ctgaaggaccagggctttgcctttgactaccgaggggagatctacgtgaagggcatcagt
gaacaggaaggaaaaatcaaaacatactttctgctgggaagagtccaacccaacccattc
atcctgcccccgagaagactgcccgggcagtactccctggccgcggtcgtcctgggcctt
gtccagtccctcaacaggcaaaggcagaagcagctgctcaacgagaacaacgccacgggg
atcatcaagggtcattacaaccggcggactttgttggcacccagcgggccagagcccgga
gccccagccgaaggcaccgacaagtccgatttgccataa

KEGG   Ailuropoda melanoleuca (giant panda): 100476495
Entry
100476495         CDS       T01329                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase type 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00230  Purine metabolism
aml01100  Metabolic pathways
aml01522  Endocrine resistance
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04072  Phospholipase D signaling pathway
aml04114  Oocyte meiosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04371  Apelin signaling pathway
aml04540  Gap junction
aml04611  Platelet activation
aml04713  Circadian entrainment
aml04714  Thermogenesis
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04727  GABAergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04913  Ovarian steroidogenesis
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04921  Oxytocin signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04961  Endocrine and other factor-regulated calcium reabsorption
aml04962  Vasopressin-regulated water reabsorption
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml04972  Pancreatic secretion
aml04976  Bile secretion
aml05032  Morphine addiction
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100476495 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100476495 (ADCY9)
   04371 Apelin signaling pathway
    100476495 (ADCY9)
   04020 Calcium signaling pathway
    100476495 (ADCY9)
   04072 Phospholipase D signaling pathway
    100476495 (ADCY9)
   04024 cAMP signaling pathway
    100476495 (ADCY9)
   04022 cGMP-PKG signaling pathway
    100476495 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100476495 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100476495 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100476495 (ADCY9)
   04062 Chemokine signaling pathway
    100476495 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    100476495 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    100476495 (ADCY9)
   04912 GnRH signaling pathway
    100476495 (ADCY9)
   04913 Ovarian steroidogenesis
    100476495 (ADCY9)
   04915 Estrogen signaling pathway
    100476495 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    100476495 (ADCY9)
   04921 Oxytocin signaling pathway
    100476495 (ADCY9)
   04926 Relaxin signaling pathway
    100476495 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    100476495 (ADCY9)
   04918 Thyroid hormone synthesis
    100476495 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    100476495 (ADCY9)
   04916 Melanogenesis
    100476495 (ADCY9)
   04925 Aldosterone synthesis and secretion
    100476495 (ADCY9)
   04927 Cortisol synthesis and secretion
    100476495 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100476495 (ADCY9)
   04270 Vascular smooth muscle contraction
    100476495 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    100476495 (ADCY9)
   04971 Gastric acid secretion
    100476495 (ADCY9)
   04972 Pancreatic secretion
    100476495 (ADCY9)
   04976 Bile secretion
    100476495 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100476495 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100476495 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    100476495 (ADCY9)
   04727 GABAergic synapse
    100476495 (ADCY9)
   04725 Cholinergic synapse
    100476495 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    100476495 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100476495 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    100476495 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    100476495 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100476495 (ADCY9)
   04714 Thermogenesis
    100476495 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100476495 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    100476495 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100476495 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100476495 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100476495 (ADCY9)
   05163 Human cytomegalovirus infection
    100476495 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100476495 (ADCY9)
Enzymes [BR:aml01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100476495 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF512 DUF1053 zf-C2HC_2 AC_N
Other DBs
NCBI-GeneID: 100476495
NCBI-ProteinID: XP_034526361
Ensembl: ENSAMEG00000010857
LinkDB
Position
10
AA seq 1352 aa
MASPPHQQLLQHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRVGAGGRLRRQKKLPQLFERASSRWWDPKFDSVKLEEACMERCFPQTQRRFRYAL
FYIGFACLLWSIYFGVHMRSKLIVMVAPALCFLVVCVGFFLFTFTKLYARHYVWTSLVLT
LLVFALTLAAQFQVLTPLSGRGDSSNHTLAAKPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLFLGVVYSVLFETFGYHFRDKDCFPPPGAGAPHWELLSRALLHVCIHAIGIHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HSTSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIRAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVTERLGQSVVADQLKGLKTYLIAGQRAKESHCSCSEALLSGFEVIDGSRVS
SGPRRQGTASPGSVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAVQNGGQEEHKN
STKAPGAPNSKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIKNSPVKTF
ASATFSSLLDVFLSTTVFLILSITCFLKYGAATTAPPPAALAVFSAALLLEMLSLVVSIR
MVFFLEDVMACTKRLLEWIAGWLPRHFIGAILVSLPALAVYSHVTSEFETNIHFTMFMGS
AVLITVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYVSLCPDSSIVISHLDAGQNFSSEG
NPCNSSLPRDGGTASLIGQEVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTKI
QSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKEC
YRVLNELIGDFDELLSRPGYSSIEKIKTIGATYMAASGLNGAQCQDGSHPQEHLQVLFEF
AKEMMCVVDDFNSNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTG
VECRIQVSEESYRILSKMGYDFDYRGTVNVKGKGQMKTYLYPKCMDSGAVPQHQLSISPD
IRVQVDGSIGRSPTDEIANLVPSVQNADKMSLSSENNVQAKDTHLSSKRPWKEPFKAEER
CRFGKAIEKSDCEEAGVEEASELTRLNVSKSV
NT seq 4059 nt   +upstreamnt  +downstreamnt
atggcttccccaccccaccagcagctgctgcagcaccacagcaccgaggtgagttgtgac
tccagcggagacagcaacagcgtaagggtcaaaatcaaccccaagcagctgtcctccaac
agccaccccaagcactgcaagtacagcatctcctccagctgtagcagctctggggactca
gggggtgtcccccggagagtgggcgctggaggccgcctgcggaggcagaagaagctgccc
cagctgttcgagagggcctccagccggtggtgggaccccaagttcgactcggtgaagctg
gaggaggcttgcatggagcgctgcttcccgcagacccagcgccgcttccggtatgcgctc
ttctacatcggcttcgcctgccttctgtggagcatctattttggggtccacatgaggtcc
aaactgattgtcatggtagccccagctctgtgcttcctcgtagtgtgtgtgggctttttc
ctgtttaccttcaccaagctgtatgcccggcattacgtatggacctctctggttctcacc
ctcctggtgttcgccctgaccctggctgcccagtttcaggttttgacgcctctctcagga
cgtggtgacagctccaatcataccctcgcagccaagcccacagacacttgcttgtctcaa
gtggggagcttttccatgtgcatcgaagtgctctttttactctacacggtcatgcaccta
cctttgtacttgagcttgtttttgggagtggtctattctgttctctttgagacctttggc
tatcatttccgagacaaagactgctttcccccacctggagcaggggcgccacactgggag
ctgctgagccgagccctgctccacgtctgcattcacgccattgggatccacctatttatc
atgtcccaggtgagatctcggagcacctttctcaaggtgggacagtcaattatgcatgga
aaggatctggaagtggaaaaagctctgaaagagagaatgattcattctgtgatgccgaga
atcatagctgatgacctgatgaaacagggggatgaggagagcgagaattctgtcaaaagg
cactcgacctccagccccaagaacaggaagaaaaagtcttccatacagaaagcccctata
gcattccgccctttcaaaatgcagcagatcgaagaagtcagtattttatttgcagatatc
gtgggcttcacaaagatgagtgccaataagtctgctcacgccctggtgggtctcctcaac
gatctgttcggtcgctttgaccggttgtgtgaagagaccaagtgtgagaaaatcagtacc
ctgggagactgctactattgtgtggcggggtgtccagagccccgggccgaccatgcctac
tgctgcattgagatgggcttgggcatgatcagagctatcgagcaattctgccaggagaag
aaagagatggtgaacatgcgtgtcggggttcacacggggactgtcttgtgcggcattttg
ggcatgaggaggttcaaattcgatgtgtggtccaatgatgtgaacttggccaatctcatg
gagcagctgggagtggcgggcaaggttcacatttctgaggccacagcaaaatacctagat
gatcggtacgaaatggaagatgggaaagttactgaacgccttggccagagtgttgttgct
gaccagttgaaaggtttgaagacatacctgatagcgggtcagagagcgaaggagtctcat
tgcagctgctcagaggccttgctttctggctttgaggtcattgacggctcacgggtgtcc
tcaggtcctaggagacaggggacagcatcgccagggagtgtcagtgatttggcgcagact
gtcaaaacctttgataaccttaagacctgtccttcatgtggaatcacgtttgcccccaaa
tcggaagctggtgcagaaggaggagcggtccaaaatggcggtcaagaggagcataaaaac
agcaccaaggctcctggagcaccgaattccaaaactcagaatggacttctgagccctccc
caagaggagaagctcaccaacagtcagacctccctgtgtgagatcttacaggaaaaggga
aggtgggcaggagtgagcttggaccagtcagctctccttccgctgagattcaagaacatc
cgggagaaaacagatgcccattttgttgatgttatcaaagaagacagcctgatgaaagat
tattttttcaagccacccatcaatcagttcagcttgaacttcctggatcaggagctagag
cgatcctacaggaccagctaccaggaagaggttataaagaattctcccgtgaagactttt
gccagtgccaccttcagctccctcctggatgtgtttctttcgacgacagtgtttctaatt
ctctctatcacctgcttcctgaagtacggggctgccaccacggctcccccgcctgccgcc
ctggcagtcttcagcgccgccctgctgctggagatgctgagccttgtggtctccatcagg
atggtgtttttcctggaggacgtgatggcctgtacgaagcgcctgctggagtggatagcc
ggctggctcccgcgccatttcattggggccatcctggtgtcactccctgctcttgcagtc
tattcacatgtcacctctgaatttgagacaaacatacacttcaccatgttcatgggctca
gccgtcctgatcaccgttgtgcactactgtaacttctgccagctcagctcctggatgagg
tcctccttagccacagtcgtcggggctgggcccctgctcctgctctatgtctccctgtgc
cctgacagttccatagtaatttcacaccttgatgcaggacagaatttcagttccgagggg
aatccgtgcaatagttccttgccgcgtgatggcggaacggccagcctgattggccaggag
gtggttcttgtcttctttctcctgctcctgttggtctggttcctgaatcgagaatttgag
gtcagctaccgcctgcactaccatggggacgtggaggcggaccttcaccgcaccaagatc
cagagcatgagggaccaagctgactggctactgagaaacatcatcccctaccacgtggcc
gagcagctgaaggtctcgcagacctactccaagaaccacgacagtggaggcgtcatcttc
gccagcatcgtcaacttcagtgagttctacgaggagaactacgaggggggcaaggagtgc
taccgggtcctcaacgagctcatcggggacttcgatgagctcctgagcaggccgggctac
agcagcatcgagaagatcaagaccattggggccacgtacatggctgcatcgggtctgaac
ggcgcccagtgccaggacggcagccacccgcaggagcacctgcaggtcctgtttgagttc
gccaaggagatgatgtgcgtggtggacgacttcaacagcaacatgctgtggttcaacttt
aagctcagggtcggcttcaaccatgggccgctcacagcgggggtcatcggcaccaccaag
ctgctgtatgacatctggggcgacaccgtcaacatcgccagcaggatggacagcacaggg
gtggagtgccgaatccaggtgagcgaggagagctatcgcatcctgagcaagatgggctat
gacttcgactaccgggggacagtgaacgtgaagggcaagggccagatgaagacctacctg
tacccaaagtgcatggacagcggggctgtgccacagcaccagttgtccatctccccggac
atccgagtccaggtggacggcagcatcgggcggtctcccacggacgagatcgccaacctg
gtgccttctgtacagaatgcagacaagatgtctctgagttccgaaaacaacgtgcaggcc
aaggacactcacctatcctctaagaggccgtggaaagagcccttcaaagccgaagaaagg
tgtcgatttggcaaagccatagagaaaagcgactgtgaagaagctggcgtagaggaagcc
agcgagctcaccaggctcaacgtttccaagagcgtgtga

KEGG   Ailuropoda melanoleuca (giant panda): 100476922
Entry
100476922         CDS       T01329                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6 isoform X2
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00230  Purine metabolism
aml01100  Metabolic pathways
aml01522  Endocrine resistance
aml04015  Rap1 signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04072  Phospholipase D signaling pathway
aml04114  Oocyte meiosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04371  Apelin signaling pathway
aml04540  Gap junction
aml04611  Platelet activation
aml04713  Circadian entrainment
aml04714  Thermogenesis
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04727  GABAergic synapse
aml04742  Taste transduction
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04913  Ovarian steroidogenesis
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04921  Oxytocin signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04924  Renin secretion
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04961  Endocrine and other factor-regulated calcium reabsorption
aml04962  Vasopressin-regulated water reabsorption
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml04972  Pancreatic secretion
aml04976  Bile secretion
aml05032  Morphine addiction
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100476922 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100476922 (ADCY6)
   04371 Apelin signaling pathway
    100476922 (ADCY6)
   04072 Phospholipase D signaling pathway
    100476922 (ADCY6)
   04024 cAMP signaling pathway
    100476922 (ADCY6)
   04022 cGMP-PKG signaling pathway
    100476922 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100476922 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100476922 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100476922 (ADCY6)
   04062 Chemokine signaling pathway
    100476922 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    100476922 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    100476922 (ADCY6)
   04912 GnRH signaling pathway
    100476922 (ADCY6)
   04913 Ovarian steroidogenesis
    100476922 (ADCY6)
   04915 Estrogen signaling pathway
    100476922 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    100476922 (ADCY6)
   04921 Oxytocin signaling pathway
    100476922 (ADCY6)
   04926 Relaxin signaling pathway
    100476922 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    100476922 (ADCY6)
   04918 Thyroid hormone synthesis
    100476922 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    100476922 (ADCY6)
   04916 Melanogenesis
    100476922 (ADCY6)
   04924 Renin secretion
    100476922 (ADCY6)
   04925 Aldosterone synthesis and secretion
    100476922 (ADCY6)
   04927 Cortisol synthesis and secretion
    100476922 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100476922 (ADCY6)
   04270 Vascular smooth muscle contraction
    100476922 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    100476922 (ADCY6)
   04971 Gastric acid secretion
    100476922 (ADCY6)
   04972 Pancreatic secretion
    100476922 (ADCY6)
   04976 Bile secretion
    100476922 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100476922 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100476922 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    100476922 (ADCY6)
   04727 GABAergic synapse
    100476922 (ADCY6)
   04725 Cholinergic synapse
    100476922 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    100476922 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    100476922 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    100476922 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    100476922 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    100476922 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100476922 (ADCY6)
   04714 Thermogenesis
    100476922 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100476922 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    100476922 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100476922 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100476922 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100476922 (ADCY6)
   05163 Human cytomegalovirus infection
    100476922 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100476922 (ADCY6)
Enzymes [BR:aml01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100476922 (ADCY6)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA TBK1_ULD Shisa
Other DBs
NCBI-GeneID: 100476922
NCBI-ProteinID: XP_019663490
Ensembl: ENSAMEG00000007210
LinkDB
Position
16
AA seq 1175 aa
MLRAGASRRETDSMSWFSGLLVPKVDERKTAWGERNGQKRPRRGTRPGGFCTPRYMSCLR
DAQPPSPTPAAPPRCPWQDEAFIRRGGPGKGTELGLRAVALGFEDVEAAAAEAAPDATPG
GRQSCWRCLAQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLMAVLLAFHAVP
ARPRPAYVALLACAAALFVALMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPR
SPSAGLWCPVFFVYITYTLLPIRMRAAVFSGLGLSTLHLILAWQLNRSDAFLWKQLGANV
LLFLCTNVIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAME
MKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDK
LAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRV
GIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPG
RGGERNAYLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRT
KDSKAFRQMGIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQ
REDLEKKYSRKLDPRFGAYVACALLASCFICFIQLLVFPHSTLMLGIYAGIFLLLLITVL
TCAVSSCGSLFPKALRRLSRSIVHSRAHSTVVGIFSVLLVFTSAIANMFTCNHTPIRTCA
ARMLNVTPVDITACHLQQLNYSLGLDAPLCEGTAPTCSFPEYFVGSVLLSLLASSVFLHI
SSIGKLAMIFVLGLVYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVA
LKYMTPVILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILP
KDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIA
DFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYDQAGRSHITALADYAMRLMEQMKHI
NEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLY
QVLAAKGYQLECRGVVKVKGKGEMTTYFLNGGPPS
NT seq 3528 nt   +upstreamnt  +downstreamnt
atgctccgggcgggggctagtcgccgagaaacagacagcatgtcgtggtttagtggcctc
ctggtccccaaagtggatgaacggaaaacagcctggggtgagcgcaatgggcagaagcgt
ccacgccgtgggactcggcccgggggcttctgcacgccccgctacatgagctgcctccgg
gatgcgcagccccccagtcccacccctgcagctccgcctcggtgcccctggcaggatgag
gccttcatccggaggggcggcccgggcaagggcacggagctggggctgcgggccgtggcc
ctgggctttgaggacgtggaggcggcggcggccgaggcggcccccgacgcgacacccggg
ggccggcaatcgtgctggcgctgcctggcccaggtgttccagtcgaagcagttccgctcg
gccaagctggagcgtctgtaccagcggtacttctttcagatgaaccagagcagcctgacg
ctgctgatggccgtgctggtgctgctcatggccgtgctgctggcctttcacgcggtgccc
gcccgccctcggcctgcctacgtggccctgctggcctgcgccgccgccctcttcgtggcg
ctcatggtggtgtgtaaccggcacagcttccgccaggactccatgtgggtggtgagctac
gtggtgctgggcatcctggcggccgtgcaggtggggggtgccctggccgccgacccccgc
agcccctccgcgggcctctggtgccccgtgtttttcgtctacatcacctacacgctcctg
cccatccgcatgcgggcggctgtcttcagcggcctgggcctgtccaccctgcatttgatc
ttggcctggcagctcaaccgcagcgacgccttcctatggaagcagctgggtgccaacgtg
ctgctgttcctctgcaccaacgtcatcggcatctgcacgcactacccggcggaggtgtct
cagcgccaggcctttcaggagacccgtggttacatccaggcccggctgcacctgcagcat
gagaatcggcagcaggaacggctgctgctgtccgtgttgccccagcatgttgccatggag
atgaaagaagatatcaacacaaagaaagaagacatgatgttccacaagatctacatccag
aagcatgacaacgtcagcatcctgtttgcagacattgaaggcttcaccagcctggcatcc
cagtgcaccgcgcaggagctggtcatgaccctgaacgagctctttgcccggtttgacaag
ctggctgcggaaaatcactgcctgagaatcaagatcttaggggactgttactactgtgtg
tcggggctgccggaggcccgggcagaccatgcccactgctgtgtggagatgggggtggac
atgatcgaggccatctcgctggtgcgtgaggtgacaggtgtgaacgtgaacatgcgtgtg
ggcatccacagcggccgtgtgcactgtggcgtccttggcctgcggaaatggcagttcgac
gtgtggtccaacgatgtgacgctggccaaccacatggaggcggggggccgggccggccgc
atccacatcacccgggccacgctgcagtacctgaacggcgactacgaggtggagccgggc
cgcggcggcgagcgcaacgcctatctcaaggagcagcacatcgagaccttcctcatcctg
ggggccagccagaaacggaaagaggagaaggccatgctggccaagctgcagcggacgcgg
gccaactccatggaagggctgatgccgcgctgggtgcccgaccgcgccttctcccggacc
aaggactccaaggctttccgccagatgggcattgatgattccagcaaagacaaccggggt
gcccaagacgccctgaaccccgaggatgaagtagatgagttcctgggccgtgccatcgat
gcccgcagcatcgatcagctacggaaggaccacgtgcgccgcttcctgctcactttccag
agagaagatcttgaaaagaagtactcgcggaagctggacccccgcttcggagcctacgtg
gcctgtgcactgttggcctcctgcttcatctgctttatccagctcctcgtcttcccacac
tccaccctgatgcttgggatctatgccggtatcttcctgctgttgctgatcactgtgctg
acctgtgccgtgtcctcctgtggctccctcttccccaaggccctgcgacgcctttcccgc
agcattgtccactctcgggcgcacagcaccgtggttggcatcttttcagtcttgcttgtg
ttcacctctgccatcgccaacatgttcacctgtaaccacacccccatacggacctgcgca
gcccggatgctgaatgtgacacccgtggacatcaccgcctgccacctgcagcagctcaat
tactccctgggtctggatgctccgctgtgtgagggcaccgcacccacttgcagcttccct
gagtacttcgttgggagcgtgctgctgagtctcctggccagctctgtgttcctgcacatc
agcagcatcgggaagttggccatgatctttgtcctggggctcgtctatttggtgctgctt
ctgctgggccccccagccaccatctttgacaactatgacctgctgcttggtgtccatggc
ttggcttcttccaatgagactttcgacgggctggactgcccagctgcagggagggtggcg
ctcaaatacatgacccccgtgattctgctggtgtttgcactggcgctgtatctgcacgcc
cagcaggtggagtcaactgcgcgcctggacttcctctggaaactgcaggcaacaggggag
aaggaggagatggaggaactccaggcctacaaccgaagactgctgcataacattctgccc
aaggacgtggctgcccacttcctggcccgggagcgccggaatgacgagctctactatcag
tcgtgtgagtgtgtggccgtcatgtttgcctccattgccaacttttctgagttctacgtg
gagctggaggccaacaacgagggcgtcgagtgtctgcggctgctcaacgagattatcgct
gacttcgacgagatcatcagcgaggagcggttccggcagctggagaagatcaagacgatt
ggtagcacctacatggctgcctcggggctgaacgccagcacctatgatcaggccggccgc
tcccacatcactgccctggccgactatgccatgcggctcatggagcagatgaaacacatc
aatgagcactccttcaacaatttccagatgaagattgggctgaacatgggcccagtcgtg
gcaggcgtcattggggctcggaagccgcagtatgacatctgggggaacacagtgaatgtc
tctagccgtatggacagcacgggggtccctgaccgaatccaggtgaccacggacttgtac
caggttctagctgccaaaggctaccagctggagtgtcgaggagtggtcaaggtgaagggc
aagggggagatgaccacctacttcctcaacgggggcccccccagttag

KEGG   Ailuropoda melanoleuca (giant panda): 100482519
Entry
100482519         CDS       T01329                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase type 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00230  Purine metabolism
aml01100  Metabolic pathways
aml01522  Endocrine resistance
aml04015  Rap1 signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04072  Phospholipase D signaling pathway
aml04114  Oocyte meiosis
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04371  Apelin signaling pathway
aml04540  Gap junction
aml04611  Platelet activation
aml04713  Circadian entrainment
aml04714  Thermogenesis
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04726  Serotonergic synapse
aml04727  GABAergic synapse
aml04728  Dopaminergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04913  Ovarian steroidogenesis
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04921  Oxytocin signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04924  Renin secretion
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml04972  Pancreatic secretion
aml04976  Bile secretion
aml05012  Parkinson disease
aml05030  Cocaine addiction
aml05031  Amphetamine addiction
aml05032  Morphine addiction
aml05034  Alcoholism
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100482519 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100482519 (ADCY5)
   04371 Apelin signaling pathway
    100482519 (ADCY5)
   04072 Phospholipase D signaling pathway
    100482519 (ADCY5)
   04024 cAMP signaling pathway
    100482519 (ADCY5)
   04022 cGMP-PKG signaling pathway
    100482519 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100482519 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100482519 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100482519 (ADCY5)
   04062 Chemokine signaling pathway
    100482519 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    100482519 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    100482519 (ADCY5)
   04912 GnRH signaling pathway
    100482519 (ADCY5)
   04913 Ovarian steroidogenesis
    100482519 (ADCY5)
   04915 Estrogen signaling pathway
    100482519 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    100482519 (ADCY5)
   04921 Oxytocin signaling pathway
    100482519 (ADCY5)
   04926 Relaxin signaling pathway
    100482519 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    100482519 (ADCY5)
   04918 Thyroid hormone synthesis
    100482519 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    100482519 (ADCY5)
   04916 Melanogenesis
    100482519 (ADCY5)
   04924 Renin secretion
    100482519 (ADCY5)
   04925 Aldosterone synthesis and secretion
    100482519 (ADCY5)
   04927 Cortisol synthesis and secretion
    100482519 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100482519 (ADCY5)
   04270 Vascular smooth muscle contraction
    100482519 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    100482519 (ADCY5)
   04971 Gastric acid secretion
    100482519 (ADCY5)
   04972 Pancreatic secretion
    100482519 (ADCY5)
   04976 Bile secretion
    100482519 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    100482519 (ADCY5)
   04727 GABAergic synapse
    100482519 (ADCY5)
   04725 Cholinergic synapse
    100482519 (ADCY5)
   04728 Dopaminergic synapse
    100482519 (ADCY5)
   04726 Serotonergic synapse
    100482519 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    100482519 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100482519 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    100482519 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    100482519 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100482519 (ADCY5)
   04714 Thermogenesis
    100482519 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100482519 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100482519 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    100482519 (ADCY5)
   05031 Amphetamine addiction
    100482519 (ADCY5)
   05032 Morphine addiction
    100482519 (ADCY5)
   05034 Alcoholism
    100482519 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100482519 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100482519 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100482519 (ADCY5)
   05163 Human cytomegalovirus infection
    100482519 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100482519 (ADCY5)
Enzymes [BR:aml01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100482519 (ADCY5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD PEN-2
Other DBs
NCBI-GeneID: 100482519
NCBI-ProteinID: XP_034526603
Ensembl: ENSAMEG00000004694
LinkDB
Position
1
AA seq 1095 aa
GKGRAVDELEAGAVDGDEGSGDGGSSAESGAGPGAVLSLGACCLALLQIFRSKKFPSDKL
ERLYQRYFFRLNQSSLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILVMAV
LCNRAAFHQDHMGLACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVR
MRAAVLSGVLLSALHLAIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQ
AFQETRECIQARLHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHD
NVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGL
PEARADHAHCCVEMGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWS
NDVTLANHMEAGGKAGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCT
QKRKEEKAMIAKMNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNA
QESANPEDEVDEFLGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVA
CASLVFLFICFVQITIVPHSVFMLSFYLTCFLLLTLVVFVSVIYSCVKLFPTPLQTLSRK
IVRSKMNSTLVGVFTITLVFLSAFVNMFTCNSKDLFGCLADEHNISTSQVNACHVVESAT
NYSLGDERGVCSSPWPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELTYVLI
VEVPRVTLFDNADLLVTANAIDFNNNGTSQCPEHATKVALKVMTPIILSVFVLALYLHAQ
QVESTARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQS
CECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIG
STYMAASGLNDSTYDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVA
GVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGK
GEMMTYFLNGGPPLS
NT seq 3288 nt   +upstreamnt  +downstreamnt
ggcaagggccgcgcggtggacgagctggaggccggcgccgtcgatggcgacgaagggtcc
ggggatggcggcagctcggcagaatcaggcgcggggcccggcgcagtgctgtcgctgggt
gcctgctgcctggcgctgctgcagatattccgctccaagaagttcccgtcggacaagctg
gagcggctgtaccagcgctacttcttccgtctgaaccagagcagcctcactatgctcatg
gccgtgctggtgctcgtgtgcctcgtcatgttggccttccacgcggcgcggcccccgctc
cagctgccctacctggcagtgctggcggctgcggtaggtgtcatcctcgtcatggctgtg
ctctgtaaccgcgccgccttccaccaggaccacatgggcctggcctgctacgcgctcatc
gccgtggtgctggccgtccaggtggtgggcctgttgctgccccagccgcgcagcgcctcc
gagggcatctggtggaccgtgttcttcatctacaccatctacacgctgctgcctgtgcgc
atgcgggccgcggtactcagtggtgtgctcctgtctgccctccacctggccatcgccctg
cgcaccaacgcccaggaccagttcctgctgaagcagcttgtctccaatgtcctcattttc
tcctgcaccaacatcgtgggtgtttgcacccactacccggctgaggtctcccagagacag
gccttccaggagacccgggagtgcatccaggcacggctccactcacaacgggagaaccag
caacaggagcggctcctgctgtctgtcctgccccgtcatgttgccatggagatgaaagca
gacatcaatgccaagcaggaggatatgatgttccataagatttacatccagaaacacgac
aacgtgagcatcctgtttgctgacatcgagggcttcaccagcctggcatcccagtgcact
gcccaggagctggtcatgaccctcaacgagctcttcgcccgattcgacaagctggctgcg
gagaatcactgtttacgtattaagatcctgggggattgttattactgtgtctctgggctg
cctgaagcgagggctgaccacgcccactgctgcgtggagatgggcatggacatgattgag
gccatctcgttggtccgggaggtgacaggggtgaacgtgaacatgcgcgtgggaattcac
agcgggcgagtacactgcggtgtccttggtctcaggaagtggcaattcgacgtctggtct
aatgacgtcacgctggccaaccacatggaagctggaggcaaggcagggcgcatccacatc
accaaggccacactcaactacctgaacggggactacgaagtggagccgggctgtgggggc
gagcgtaacgcctacctcaaggagcacagtatcgagaccttcctcatcctgcgctgcacc
cagaagcggaaagaagaaaaggccatgatcgccaagatgaatcgccagagaaccaactcc
attgggcacaacccgccccactggggggccgagcgtcccttctacaaccacctggggggc
aaccaggtgtccaaggagatgaagcggatgggcttcgaagaccccaaggacaagaacgcc
caagaaagtgcaaaccctgaggacgaagtggatgaatttctgggccgtgccattgacgcc
aggagcattgacaggctgcggtctgagcatgtccgcaagttcctcttgaccttcagggag
cctgacttagagaagaagtactccaagcaggtggatgaccgattcggtgcctacgtggca
tgtgcctcgcttgtcttcctcttcatctgctttgtccagatcaccatcgtgccccactcc
gtgttcatgttgagtttctacctgacctgtttcctgctgctgacgttggtggtatttgtg
tccgtgatctattcctgcgtgaagctcttccccaccccactgcagaccctctccaggaag
attgtgcggtccaagatgaatagcactctggttggcgtgttcaccatcactctcgtgttc
ctctcggctttcgtcaacatgttcacatgtaactccaaggacctgttcggctgcctggcg
gacgagcacaacatcagcaccagccaggtcaacgcgtgccacgtggtggagtcggccacc
aactacagcctgggggacgagcggggcgtctgcagcagcccgtggcccaactgtaacttc
cctgagtacttcacctacagcgtgctgctcagcctgctggcctgctccgtgttcctgcag
atcagctgcattgggaagctggtgctcatgctggccattgagctcacgtacgtgctcatc
gtcgaggtgccccgagtcacgctctttgacaatgccgacctgctggtcaccgccaatgcc
atagacttcaacaacaacgggacctcccagtgccctgagcatgcgaccaaggtggcactg
aaggtgatgacgcccatcatcctctccgtctttgtgctggccctgtacctgcacgcccag
caagtggagtccactgcccgcctggacttcctctggaaactgcaggccacggaggagaaa
gaggagatggaggagctgcaggcctacaaccggcggctgttgcacaacatcctgcccaag
gacgtggctgcccactttctggcccgcgagcggcgcaacgacgagctctactaccagtcg
tgcgagtgcgtggctgtcatgttcgcctccatcgccaacttctccgagttctacgtggag
ctggaggccaacaatgagggcgtcgagtgcctgcggctgctcaatgagatcatcgccgac
tttgatgagatcatcagtgaggatcggttcaggcagctggagaagatcaagaccatcggc
agcacctacatggccgcctcaggcctcaatgactctacgtatgacaaggtgggcaagacc
cacattaaagccctggccgacttcgccatgaagctcatggaccaaatgaagtacatcaat
gaacactccttcaacaacttccagatgaagattgggctcaacatcggccctgtggtggcc
ggggtgatcggggctcgcaagccgcagtacgacatctggggcaatacggtgaacgtggcc
agccgcatggacagcaccggtgtgcccgaccgcatccaggtcaccacagacatgtaccag
gtgctggctgccaacacataccagctggagtgcaggggtgtggtcaaggtcaagggcaaa
ggcgagatgatgacctacttcctcaacggggggcccccgctcagttag

DBGET integrated database retrieval system